Nucleic Acids Research Advance Access originally published online on October 13, 2006
Nucleic Acids Research 2006 34(20):5764-5777; doi:10.1093/nar/gkl722
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Nucleic Acids Research, 2006, Vol. 34, No. 20 5764-5777
© 2006 The Author(s)
This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/2.0/uk/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
RNA |
Characterization of a nucleocapsid-like region and of two distinct primer tRNALys,2 binding sites in the endogenous retrovirus Gypsy
LaboRetro, Unité de Virologie Humaine INSERM, IFR 128, Ecole Normale Supérieure de Lyon, 46 Allée d'Italie, 69364 LYON Cedex 07, France 1 Institut de Génétique Humaine 141, rue de la Cardonille, 34396 MONTPELLIER Cedex 5, France
*To whom correspondence should be addressed. Tel: +33 4 72 72 81 69; Fax: +33 4 72 72 87 77; Email: Jean-Luc.Darlix{at}ens-lyon.fr
Received August 28, 2006. Revised September 18, 2006. Accepted September 18, 2006.
| ABSTRACT |
|---|
|
|
|---|
Mobile LTR-retroelements comprising retroviruses and LTR-retrotransposons form a large part of eukaryotic genomes. Their mode of replication and abundance favour the notion that they are major actors in eukaryote evolution. The Gypsy retroelement can spread in the germ line of the fruit fly Drosophila melanogaster via both env-independent and env-dependent processes. Thus, Gypsy is both an active retrotransposon and an infectious retrovirus resembling the gammaretrovirus MuLV. However, unlike gammaretroviruses, the Gypsy Gag structural precursor is not processed into Matrix, Capsid and Nucleocapsid (NC) proteins. In contrast, it has features in common with Gag of the ancient yeast TY1 retroelement. These characteristics of Gypsy make it a very interesting model to study replication of a retroelement at the frontier between ancient retrotransposons and retroviruses. We investigated Gypsy replication using an in vitro model system and transfection of insect cells. Results show that an unstructured domain of Gypsy Gag has all the properties of a retroviral NC. This NC-like peptide forms ribonucleoparticle-like complexes upon binding Gypsy RNA and directs the annealing of primer tRNALys,2 to two distinct primer binding sites (PBS) at the genome 5' and 3' ends. Only the 5' PBS is indispensable for cDNA synthesis in vitro and in Drosophila cells.
| INTRODUCTION |
|---|
|
|
|---|
Retrotransposons and retroviruses belong to a large family of mobile genetic elements called long terminal repeat (LTR) containing retroelements (1). Ancient retrotransposons, such as yeast transposons (TY) share common genetic features with simple retroviruses, such as vertebrate gammaretroviruses and utilize similar basic mechanisms for their replication. Genome replication proceeds via the conversion of the single-stranded genomic RNA into a double-stranded DNA copy with two LTRs by reverse transcriptase (RT), followed by integration into the host genome by integrase (1). By virtue of this copy-and-paste mechanism, retrotransposons are thought to have efficiently invaded eukaryotic genomes. Being a large part of eukaryotic genomes, these LTR-retroelements are viewed as major players in eukaryote evolution (2).
A large number of studies on the early replication steps of lentiviruses and gammaretroviruses, such as HIV-1 and MoMuLV, respectively, have been carried out in in vitro reconstituted systems and in cell culture [reviewed in (35)]. Collectively the findings show that reverse transcription occurs within the virion nucleocapsid (NC) structure formed of the genomic RNA coated by molecules of NC protein, and starts by NC-mediated annealing of a specific cellular primer tRNA to a unique 5' genomic primer binding site (PBS), followed by RT-directed cDNA synthesis during which RT is assisted by NC (35). Much less studies have been carried out on the early replication steps of ancient retrotransposons, such as TYs of yeast. Although a similar basic mechanism appears to operate, such as RT-directed cDNA synthesis by extension of a specific cellular tRNA annealed to a genomic PBS within a ribonucleoprotein structure, several important differences were discovered. The genomic PBS is not unique but multipartite in TY1 and TY3, and unique genomic 5'3' interactions appear to exert a control over reverse transcription and consequently on the genetic amplification of these retrotransposons (68).
As it is well documented for HIV-1, NC protein in its mature form plays critical roles in the conversion of the genomic RNA into proviral DNA by RT through specific and tight interactions with the genomic RNA, primer tRNALys,3, RT and the newly made cDNA [reviewed in (35)]. Interestingly, retrotransposon NC proteins can either contain a canonical CCHC zinc finger RNA-binding motif and be processed by protease cleavage of the Gag polyprotein, such as in TY3, or else Gag is not processed and does not contain a zinc finger motif, such as in TY1 (911). Nevertheless, the retroviral NC functions appear to be conserved in these retrotransposons since the C-terminal region of TY1 Gag chaperones the annealing of primer tRNAMet,i to the 5' multipartite PBS, mediates TY1 RNA dimerization, and assists cDNA synthesis by the homologous RT (12).
Gypsy is a retroelement present in the germ line of the fruit fly Drosophila melanogaster and can spread via cell-free viral infection. Thus, Gypsy can be considered both as an active retrotransposon and an infectious retrovirus (13,14). In agreement with this notion, the genetic structure of Gypsy is similar to that of the murine gammaretrovirus MuLV with Gag, Pol and Env flanked by two LTRs (15,16). However, the Gypsy Gag structural protein is not processed into Matrix, Capsid and NC proteins (B.V. Syomin and A. Pelisson, unpublished data), which is reminiscent of Gag of the yeast TY1.
These functional and genetic features of Gypsy make it a very attractive model to study replication of a mobile genetic element, which is at the frontier between ancient retrotransposons and retroviruses. To that end we set up an in vitro replication system using Gypsy RNAs representing the genomic RNA 5' and 3' regions, and cellular primer tRNALys,2, and investigated their interactions with a putative NC-like domain in Gag. Here we report that an unstructured domain of Gypsy Gag has the hallmarks of an active retroviral NC. This NC-like domain forms ribonucleoparticle-like complexes upon binding Gypsy RNA in vitro. In addition, two distinct primer tRNALys,2 binding sites of 11 nt were identified at the 5' and 3' ends of the genome. We also found that the Gypsy NC-like peptide can direct the annealing of tRNALys,2 to these Gypsy PBSs but only the 5' PBS appears to be indispensable for cDNA synthesis in vitro and in Drosophila cells.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Plasmid construction
Template DNA pBSG8
The XhoI fragment (39 to 6949) of Gypsy DNA (GenBank accession no. M12927 [GenBank] ) was inserted into the SalI site of the Bluescribe F'. The clone was selected so that the EcoRI site of the polylinker was at the 5' end.
Plasmid DNAs encoding Gypsy 5' and 3' RNAs were constructed by cloning a high fidelity PCR generated fragment containing two restriction sites at its ends, using the pBSG8 clone DNA as template and the oligonucleotide primers described in Supplementary Table 1.
The tRNALys,2 encoding DNA was constructed as described previously (17).
Wild-type plasmid DNA used for transfection
Wild-type constructs pDm111 (15) and 111xw (Nathalie, unpublished data) were kindly provided by N. Lyubomirskaya. They both contain the same functional Gypsy/mdg4 element except that, in 111xw, a PvuI site replaced the XhoI restriction site of the 3' LTR. The EcoRIPstI fragment containing the 816 3' nt of Gypsy, including the modified 3' LTR, was subcloned into pBluescript II KS(-) (Stratagene) to produce clone DNA #p18. The LTR+130UTR plasmid (18), kindly provided by S. Jensen, was used as a template to PCR amplify the 130 bp long copia enhancer with the following KpnI and XhoI primers: 5'-GGGGTACCCAGTCCATGCCTAATAAAC-3' and 5'-ACCGCTCGAGCTGAGAAGGAAATAATTTC-3'.
The amplified DNA fragment was cut with KpnI and XhoI and ligated to the 5' end of the 6.4 kb XhoIEcoRI Gypsy fragment of pDm111 into the pBluescript II KS(-) vector, yielding construct DNA #p19. The 800 bp EcoRIBamHI fragment from DNA #p18 was inserted into DNA #p19, giving rise to the full-length wild-type (WT) Gypsy construct.
Mutant plasmid DNAs used for transfection
A frameshift starting at codon 40 of the Gag gene was obtained by filling in with Klenow polymerase the NcoI site of the WT plasmid. The 1.2 kb XhoIKpnI fragment from WT was subcloned into pBluescript II KS(-) to delete the putative 5' PBS sequence (TGGCGCCCAAC) using the QuikChange® system (Stratagene) with oligonucleotides used for pBSG8-CG2 (Supplementary Table 1). The XhoINcoI 1 kb mutated fragment was then excised and swapped with the corresponding wild-type fragment of the WT plasmid, generating the
5' PBS Gypsy DNA. The same procedure was used to delete the four 3' nt (CAAC) of the 5' PBS. The 3' PBS sequence (CCACGACCCTG) was deleted from DNA #p18 using the QuikChange® system (Stratagene) with the oligonucleotides used for pBSG8-CG4 (Supplementary Table 1). The modified EcoRIBamHI fragment was then inserted into DNA #p19 to yield the
3' PBS Gypsy DNA. All DNA constructs were verified by sequencing.
Proteins and peptides
The TYA1-D NC-like peptide was obtained by opfp chemical synthesis and purified by high-performance liquid chromatography (HPLC) as described before (12,19). The murine leukemia virus (MLV) and HIV-1 NC basic peptides were also obtained by opfp chemical synthesis and purified to homogeneity as described before (1922). Using the one letter code representation, the MLV-NC peptide is: 'RQGGERRRSQLDRDQCAYCKEKGHWAKDCPRKPRGPRAT' where the unique zinc finger is underlined, and the HIV-1 NC peptide is: 'TVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQ' where the two zinc fingers are underlined. All peptides were dissolved at 1 mg/ml in a buffer containing 30 mM HEPES (pH 6.5), 30 mM NaCl and 0.1 mM ZnCl2. MLV RT was from Invitrogen.
DNA encoding the NC-like region of Gypsy Gag was obtained by PCR amplification using pBSG8 as template (see above) and inserted into pIVEX2.4d (Roche) using the SacII and BamHI sites. The sequence of the Gypsy NC-like peptide is shown in Figure 2B. In addition, a His-tag was present at its N-terminus (MSGSHHHHHHSSGIEGRG). The peptide was expressed in Escherichia coli after overnight induction at 18°C since it proved to be highly toxic at temperatures above 20°C. The peptide was purified in denaturing conditions on Ni-NTA column (Qiagen) and eluted with 100 mM NaH2PO4, 10 mM TrisHCl, 8 M urea at pH 4.5. Fractions containing the peptide with the highest degree of purity were further diluted with 3 vol of 30 mM HEPES (pH 6.5), 30 mM NaCl and 0.1 mM ZnCl2 and chromatographed on an Amicon ultra-4 column. The peptide was stored at 1 mg/ml in the above buffer. Note that all buffers were extensively degassed before use.
DNA templates and RNA synthesis
Plasmid DNAs for 5' RNA synthesis were generated by digesting pBSG8-CG1 (wt) and pBSG8-CG2 (
PBS) with XmnI (position 433). DNAs for 3' RNA and 5'3' RNA synthesis were obtained by digesting pBSG8-CG3 to CG8 (wt and mutants) with NsiI (position 6941), treated by the Klenow polymerase to remove the 3' strand overhang before in vitro transcription.
DNA template for tRNALys,2 synthesis was obtained by digesting the tRNALys,2 plasmid with BstNI in order to generate the primer tRNA ending at CCA.
All RNAs were prepared by in vitro transcription with T7 RNA polymerase according to the manufacturer's instructions (Promega). Gypsy RNAs were further purified by spin-column chromatography (S-300 HR, Amersham Biosciences) and dissolved at 1 mg/ml in sterile water.
Primer tRNALys,2 was purified by PAGE in 7 M urea and 0.5x TBE, recovered and dissolved at 0.05 mg/ml, and subsequently heat-denatured and slowly cooled down in the presence of 1 mM MgCl2 for proper folding. Primer tRNALys,2 was labelled by incorporation of [32P]UMP during transcription.
Binding of the Gypsy NC peptide to RNA
32P-labelled Gypsy 5' or 3' RNA (5 x 108 M) was incubated with Gypsy NC, TYA1-D, MLV-NC or HIV-1 NC at protein to nucleotide molar ratios as indicated in the figure legend, at 30°C for 5 min in 10 µl assays containing 20 mM TrisHCl (pH 7.5), 30 mM NaCl, 0.1 mM MgCl2, 5 mM DTT, 0.01 mM ZnCl2 and 8 U RNasin (Promega). Reactions were stopped by adding 5 mM EDTA and centrifuged for 30 min at 13 000 r.p.m. at 4°C. Supernatants were completely removed by pipetting. Subsequently, 32P radioactivity in the supernatant and pellet fractions was monitored in a Packard 1900 TR scintillation counter.
Primer tRNALys,2 annealing to Gypsy RNA
Gypsy RNA, wt or mutant (5 x 108 M), and 32P-tRNALys,2 (6 x 108 M) were incubated with nucleic acid chaperone (at concentrations indicated in figure legends) at 30°C for 5 min in 10 µl assays containing 20 mM TrisHCl (pH 7.5), 30 mM NaCl, 0.1 mM MgCl2, 5 mM DTT, 0.01 mM ZnCl2 and 8 U RNasin (Promega). Reactions were stopped by addition of SDS/EDTA (0.5%/5 mM final concentrations) and proteins were subsequently removed by proteinase K digestion (3 µg) at room temperature for 10 min and RNAs were phenolchloroform extracted. RNAs were analysed by 1.3% native agarose gel electrophoresis in 0.5x TBE. The gel was fixed with 10% trichloroacetic acid, dried and autoradiographed. 5' 32P-labelled FX174 DNA HinfI markers (Promega) were used for size determination (data not shown). Quantifications were carried out by laser scanning as described before (8).
Synthesis of Gypsy cDNA in vitro
Gypsy 5' or 5'3' RNA (5 x 108 M) and 32P-labelled tRNALys,2 (1 x 107 M) were incubated with nucleic acid chaperone (at protein concentrations indicated in the figure legend) at room temperature for 10 min in 10 µl buffer containing 20 mM TrisHCl (pH 7.0), 30 mM NaCl, 0.1 mM MgCl2, 5 mM DTT, 0.01 mM ZnCl2 and 10 U RNasin (Promega) (2022).
The reaction volume was then increased to 25 µl by addition of 100 U of MLV RT (Invitrogen), 0.25 mM of each dNTP, 30 mM NaCl and 2.8 mM MgCl2. Incubation was for 5 min at room temperature, and then 1 h at 30°C to allow synthesis of Gypsy minus strand cDNA. Reactions were stopped by adding SDS/EDTA (0.5%/5 mM final concentrations) and heated for 3 min at 60°C. Proteins were removed by phenolchloroform extraction and nucleic acids were precipitated by ethanol. Samples were resuspended in 10 µl formamide buffer (97% formamide, 1 mM EDTA, 0.02% bromophenol blue and 0.02% xylene cyanol), denatured for 2 min at 95°C and resolved by denaturing 8% PAGE-7 M urea in 0.5x TBE. Subsequently the gel was fixed, dried and autoradiographed. 5' 32P-labelled FX174 DNA HinfI markers (Promega) were used for size determination.
Inhibition of self-primed cDNA synthesis in vitro
Gypsy 5' RNA (5 x 108 M) was incubated with the NC-like peptide as described above but in the absence of the tRNA primer. For cDNA synthesis, the reaction volume was increased to 25 µl by addition of 100 U of MLV RT (Invitrogen), 30 mM NaCl and 2.8 mM MgCl2, and nucleotides (0.25 mM dATP, dGTP, dTTP, 25 µM dCTP and 20 µCi [32P]dCTP). Incubation, product purification and gel analysis were the same as for initiation of cDNA synthesis by primer tRNA (see section above).
DNA transfection into Drosophila cells and Southern blotting
Exponentially growing Drosophila hydei Dh33 adherent cells were grown at 26°C in Schneider medium supplemented with 10% fetal calf serum (FCS). About 3 x 106 cells were seeded in 9.6 cm2 wells containing 2 ml medium. They were transfected 24 h later with 0.8 µg of plasmid DNA, according to the protocol recommended by Qiagen: 100 µl DNA in EC buffer, 6.4 µl enhancer solution, 20 µl Effectene and 600 µl culture supernatant were successively mixed at 10 min intervals and deposited on the remaining 1.4 ml of culture. Forty-eight hours later, 2 ml of medium were added to the cells, which were transferred into a 25 cm2 flask. Three days after transfection with the LTR+130UTR control plasmid (18), up to 10% of the cells scored positive for X-Gal staining.
Transfected cells were collected at 72 h, then washed twice with 8 ml PBS and the pellet was resuspended in 200 µl [10 mM TrisHCl (pH 8), 1 mM EDTA and 10 µg·ml1 RNase I). Lysis was achieved by adding 200 µl [200 mM TrisHCl (pH 8), 200 mM EDTA and 2% SDS] and the mixture was incubated for 30 min at 70°C. Proteins were precipitated by addition of 60 µl 3 M KoAc (pH 5.2) and incubating the mixture for 30 min at 0°C. The supernatant was successively extracted with phenol/chloroform (1:1) and chloroform/isoamyl alcohol (24:1) and adding 0.3 M sodium acetate (pH 5.2) and 70% ethanol precipitated the DNA.
Half of each extract was digested with 60 U of the methylation-sensitive DpnI restriction enzyme (New England Biolabs), ethanol precipitated and then split into four parts, which were incubated with restriction enzymes as indicated in Figure 9.
Identical amounts of nuclease restricted DNA were run on a 0.7% agarose gel in TBE 1x, partially depurinated, denatured and capillary transferred in 10x SSC on a Nytran N membrane (Schleicher & Schuell). Hybridization with a randomly primed DNA probeGypsy coordinates 30975759 (16)was performed in 50% formamide, 5x SSC, 5x Denhardt's solution, 0.1% SDS, at 42°C. After washing at 55°C in (0.1x SSC and 0.5% SDS), the membrane was exposed in a Storm 820 phosphorimager (Molecular Dynamics).
| RESULTS |
|---|
|
|
|---|
Identification of a NC-like region in Gypsy Gag (ORF1)
The NC proteins of retroviruses and retroelements are small basic proteins with nucleic acid chaperone activities, generated upon processing of the Gag polyprotein by the viral protease (3). Most NC proteins are characterized by the presence of one or two Cx2Cx4Hx4C motifs, called CCHC zinc fingers (23), constituting a specific RNA-binding motif (4,24). However, a number of LTR-containing retroelementsincluding Gypsylack zinc fingers and their Gag is not processed by the protease into matrix, capsid and NC proteins [(12,25,26), and B.V. Syomin and A. Pelisson, unpublished data]. Nevertheless, NC functions may be conserved even in these cases, as evidenced by the Gag protein of the yeast TY1 retrotransposon. Indeed the Gag C-terminal domain of TY1 possesses nucleic acid binding and chaperoning properties, promoting replication primer tRNAMet,i annealing to the RNA genome and initiation of cDNA synthesis by RT (12).
Since NC activity appears to be ubiquitous in functional retroelements (27), we decided to search for an NC-like domain in Gypsy Gag (ORF1). Owing to the absence of a consensus RNA-binding motif or considerable homology to known NC proteins [(26) and data not shown], we took advantage of physico-chemical features probably shared by all NC and NC-like proteins.
The regions flanking the zinc fingers in NC proteins contain low amino acid complexity regions and are rich in proline and basic amino acid residues (26). Proline and charged amino acids as well as low complexity were suggested to contribute to the flexibility of a polypeptide chain (28). Indeed, the solution structures of NCp7 and NCp10 show that these proteinswith the exception of the short zinc finger region(s) (see Materials and Methods)are poorly structured when not bound to nucleic acids (2931). This flexibility (i.e. intrinsic disorder) might be an important prerequisite both for the multimerization of NC proteins (32) and for their RNA chaperone function (33,34). Based on these considerations, we propose that the presence of a markedly basic, disordered region in retroviral/retroelement Gag may be a good indicator of NC function in the absence of well characterized RNA-binding domain(s) with CCHC zinc fingers.
Relatively long unstructured regions can be predicted from amino acid sequence with considerable accuracy. We used the DisProt VL3-H predictor [http://www.ist.temple.edu/disprot/predictor.php, (35)] to assess the probability of disorder in Gypsy Gag. As shown in Figure 1A, the N-terminal and central regions of Gag are predicted to be mostly ordered and do not show a distinctive basic character. However, an approximately 100 amino acid region at the C-terminal end of Gag (between 300 and 400 amino acid) contains predominantly basic amino acid clusters in a putatively disordered environment, a pattern characteristic of retroviral NC proteins [(34) and data not shown]. In agreement with this prediction, an arginine-rich region (355389 amino acid) has been previously proposed to act as a possible RNA-binding domain of Gypsy Gag (36).
|
The Gag region encompassing residues 289404 was PCR-amplified and cloned into the pIVEX2.4d vector. The corresponding peptide was found to be toxic in E.coli and to aggregate (data not shown). To circumvent these difficulties it was necessary to express the peptide at 18°C. Due to a very low level of expression (Figure 1B, lane 1) we had to insert a His-tag at the N-terminus in order to achieve an efficient purification and to obtain a peptide at about 95% purity (Figure 1B, lane 2). This Gypsy Gag peptide was found to bind Gypsy RNA and tRNA with a high affinity similar to the NC-like peptide derived from the yeast retrotransposon TY1 Gag, termed TYA1-D (see Figure 2) (data not shown). This prompted us to investigate its RNA condensing and chaperoning properties using in vitro generated RNAs mimicking the 5' and 3' regions of the Gypsy genome (Figure 3).
|
|
The Gypsy NC peptide has RNA-binding and condensing properties
One hallmark of viral RNA chaperone proteins, such as retroviral NC proteins is that they cause RNA aggregation and condensation (12). Under in vitro conditions, large ribonucleoprotein complexes are formed and can be recovered by centrifugation. To analyse the ability of Gypsy NC to form large ribonucleoproteins, Gypsy NC32P-RNA complexes were formed at 30°C and recovered by centrifugation at 13 000 r.p.m. (see Materials and Methods). Radioactivity in the supernatant and in the nucleoprotein-containing pellet was monitored. Results show that the Gypsy NC (G-NC) caused RNA condensation at a protein to nucleotide molar ratio of 1:6, both with the Gypsy 5' and 3' RNAs (Figure 4). At a protein to nt molar ratio of 1:12, 5060% of the RNA was found in nucleoprotein complexes (Figure 4) in agreement with the fact that about half of the Gypsy 32P-RNA was bound to Gypsy NC as indicated by gel retardation assays (data not shown). The TYA1-D peptide (12) was used as a positive control and, as expected, had a similar RNA condensing activity (Figure 4).
|
The observed RNA aggregation cannot be exclusively attributed to charge neutralization caused by the basic amino acids in Gypsy NC (pI = 10.46) and TYA1-D (pI = 10.24), since the similarly basic MLV-NC and HIV-1 NC peptides (with pI values of 10.2 and 9.42, respectively) failed to induce considerable RNA aggregation of the Gypsy 5' and 3' RNAs (Figure 4; MLV and HIV-NC bars).
The Gypsy NC peptide directs annealing of tRNALys,2 to two 5' and 3' PBSs
In order to set up an in vitro Gypsy replication system, we needed to know whether the 5' PBS was unique, bipartite or multipartite as in retroviruses and in the yeast retrotransposons TY3 and TY1, respectively (3,6,7). Sequence alignments using tRNALys,2 and the complete Gypsy sequences were performed. As reported in Figure 5A, a PBS of 11 nt in length and rich in GC is located immediately 3' of the 5' LTR at positions 245255, complementary to the 3' end of the tRNALys,2 acceptor stem (Figure 5B). Interestingly, another putative tRNALys,2 binding site was found close to the genomic RNA 3' end at positions 6489 to 6499, also 11 nt in length and rich in GC (Figure 5A). This second PBS is complementary to a different region of tRNALys,2, namely part of the anticodon and T
C stems (Figure 5B). To assess the role of these 5' and 3' PBSs in primer tRNALys,2 annealing and initiation of reverse transcription, we generated several different RNAs mimicking the 5' and 3' regions of Gypsy genomic RNA containing the wild-type sequences, or a deleted PBS, and recombinant RNAs where the 5' and 3' regions have been fused in the wild-type sequence context or containing either one or both deleted PBSs (Figure 3; see Gypsy RNAs named BSG8-CG 1 to 9).
|
To examine primer tRNALys,2 annealing to the 5' and 3' PBSs we used the 5', 3' and 5'3' Gypsy RNAs generated in vitro (see Materials and Methods, and Figure 3). The Gypsy NC (G-NC) or the TYA1-D peptide was added to the assays together with 32P-labelled tRNA. At the end of the incubation period, 32P-labelled nucleic acids were purified by proteinase K (PK) digestion and phenol extraction, and subsequently analysed by gel electrophoresis in native conditions followed by autoradiography. As reported in Figure 6A, the Gypsy NC and TYA1-D peptides promoted extensive annealing of tRNALys,2 to the 5' PBS (lanes 27) and, as expected, not to the 5' RNA lacking the PBS (lanes 1314). Both peptides also chaperoned the annealing of tRNALys,2 to the 3' PBS, but somewhat less efficiently than to the 5' PBS (Figure 6B, lanes 27). Despite many attempts, the level of tRNALys,2 annealing to the 3' PBS never reached more than 3040% with TYA1-D and 4060% with Gypsy NC as compared with the 5' PBS. As expected, in the absence of 3' PBS no tRNA annealing took place (lanes 1314). At the same time, the MLV and HIV-NC peptides were found to be poorly active (Figure 6A and B, lanes 811) although they contain zinc fingers shown to specify direct NC/RNA recognition (3,5,24).
|
|
We used a recombinant 5'3' RNA representing the 5' and 3' regions of the Gypsy genomic RNA to better understand what could be the interactions between the 5' PBStRNA and the 3' PBStRNA complexes since different tRNALys,2 sequences of 11 nt should be base paired to the Gypsy 5' and 3' PBSs (Figure 5B), thus possibly forming a link between the ends of Gypsy genomic RNA in a manner similar to yeast TY3 RNA and primer tRNAMet,i (7). Overall, the Gypsy NC and TYA1-D peptides still directed tRNA annealing to the PBSs (Figure 6C, lanes 25 and 2025). Deleting the 5' or 3' PBS did not result in levels of tRNA annealing to the 5' PBS or 3' PBS (Figure 6C, lanes 710 and 1215, respectively) similar to those obtained with the 3' RNA or 5' RNA alone (compare with wt RNAs in Figure 6A and B). As before, the MLV and HIV-NC peptides were inactive (lanes 2629). Taken together, these results indicate that complex interactions are probably taking place between Gypsy 5' and 3' terminal regions, probably competing with the binding to tRNALys,2.
To investigate how tRNALys,2 could possibly establish a bridge between the 5' and 3' ends of the Gypsy genomic RNA, we analysed the simultaneous binding of tRNA to the PBSs situated on two RNA molecules. To this end, Gypsy 5' and 3' RNAs were co-incubated with tRNA and the TYA1-D or Gypsy NC peptide. After peptide removal by SDS-proteinase K digestion and phenol extraction, RNAs were subjected to electrophoresis in native conditions. As shown in Figure 7, an RNA complex formed of the 5' and 3' RNAs, and tRNA was generated upon addition of TYA1-D or G-NC in a dose dependent manner (lanes 25) when both PBSs were present. However, this complex did not form upon deleting the PBS from the 3' RNA (lanes 710). Similar results were obtained with the Gypsy 5' RNA with a deleted PBS (data not shown). These results indicate that the Gypsy primer tRNA can establish a bridge between the 5' and 3' ends of the genomic RNA (see Discussion).
Influence of the Gypsy NC peptide on cDNA synthesis in vitro
To examine the influence of the Gypsy NC peptide and the role of the 5' and 3' PBSs on Gypsy cDNA synthesis, we used the 5', 3' and 5'3' RNAs as well as the PBS-mutated RNAs (Figure 3). Reverse transcription by the related MLV RT proceeded at 30°C for 1 h, after which cDNAs were recovered by SDS-PK treatment and phenol extraction, and analysed by gel electrophoresis in denaturing conditions (see Materials and Methods). The Gypsy NC and TYA1-D peptides directed tRNALys,2 hybridization to the 5' PBS (Figures 6 and 7) that allowed strong stop cDNA (ss-cDNA) synthesis by RT using the 5' RNA template (Figure 8, lanes 27). In the absence of NC peptide no ss-cDNA was made, in agreement with the fact that little or no primer tRNA was annealed to the 5' PBS (lane 1). Since tRNA annealing to the 3' PBS did not involve its 3' terminal nucleotides (Figure 5), no cDNA was synthesized using the 3' RNA (lanes 910).
|
We next examined the influence of the 3' PBS on ss-cDNA synthesis initiated at the 5' PBS using the 5'3' RNA template. Results were very similar to the previous ones since only the 5' PBS was capable of directing ss-cDNA synthesis by RT (compare lanes 1517 and 20) with only a little influence of the 3' PBS (compare lanes 1517 and 2527). However, only the Gypsy NC peptide was effective at stimulating cDNA synthesis using the 5'3' RNA template (compare lanes 1214 and 1517). Similar results were obtained upon mixing the 5' and 3' RNA templates (data not shown). Both the TYA1-D and Gypsy NC peptides were found to strongly inhibit cDNA synthesis by self-priming (Supplementary Figure 1), which further support the specific role of NC protein in proviral DNA synthesis in most, if not all retroviruses (3).
Analysis of Gypsy cDNA synthesis in D.hydei cells
Lyubomirskaya et al. (37) have developed a simple ex vivo assay to look for Gypsy cDNA synthesis, which allows the direct detection of Gypsy reverse transcription by Southern blotting in stably transformed Dh14 cells. These D.hydei cells were chosen because their genome does not cross-hybridize with the D.melanogaster Gypsy sequences. The rationale of this assay is that a small 5' end deletion in a LTR retroelement still allows the production of a full-length transcript, which is subsequently used as a template to generate a complete cDNA with a restriction map different from that of the deleted donor DNA. This assay benefited here from a slight modification of the donor plasmid where a strong enhancer sequence from the copia retrotransposon (18) was inserted upstream of the Gypsy promoter, replacing the U3 sequence from the 5' LTR (see Materials and Methods). To improve the signal-to-noise ratio, we took advantage of the fact that the donor plasmid DNA was of prokaryotic origin and could be selectively degraded into small DNA fragments by the DpnI enzyme. The newly made cDNA and a minority of the parental DNA, which happened to have replicated in these Dh cells, are devoid of the methylation tags and are therefore resistant to DpnI.
The results reported in Figure 9 (lanes 58, WT) show that the unintegrated cDNA products, i.e. the linear and both the 1-LTR and 2-LTR circles, were found by Southern blotting as early as three days after transfection. To investigate the role of the 5' PBS we constructed a
5' PBS mutant producing a genomic RNA missing the 11 nt, which hybridize to the 3' terminus of primer tRNALys,2. Using Gypsy anti-Gag and anti-Env antibodies, we showed by western immuno-blotting of cellular protein extracts that this 5' PBS deletion did not affect Gypsy protein expression (data not shown). Results show that only the mutant donor plasmid DNA was detected by Southern blotting, clearly indicating that the 5' PBS is required for Gypsy cDNA synthesis. This is also in complete agreement with the in vitro data (Figure 8, lanes 17 and 20). A smaller 5' PBS deletion has been made (see Materials and Methods) and results confirmed that the 5' PBS is essential for Gypsy cDNA synthesis ex vivo (data not shown).
|
Next, we constructed the
3' PBS mutant by deleting nt 67276737 (Materials and Methods). This
3' PBS mutant displayed a wild-type level of cDNA made (compare lanes 12 with 56, and 1112 with 78) despite the fact that it does not produce any envelope protein due to the frameshift generated by this 11 nt deletion at the Env 3' end (data not shown). To further address the role of Gag in the synthesis of Gypsy cDNA, we inserted a frameshift mutation at the 5' end of Gag. This Gypsy mutant that cannot express the Gag protein was totally unable to direct cDNA synthesis (data not shown). In conclusion, these results confirm the in vitro findings (Figure 8; lanes 17 and 27) and show that the 3' PBS is not required for cDNA synthesis, at least at this stage of Gypsy replication. | DISCUSSION |
|---|
|
|
|---|
The D.melanogaster Gypsy retroelement has a genetic organization similar to that of the widespread vertebrate gammaretroviruses, such as the MLV. In fact the provirus form of Gypsy contains the three canonical open reading frames gag, pol and env flanked by two LTRs. As an infectious enveloped retrovirus, Gypsy can efficiently invade the germ line of permissive flies, upon infection of naive females (38,39). These new Gypsy proviruses can then increase their number by expression in the somatic cells of permissive flamenco females followed by recurrent invasion of the germ line by a process, which, in contrast to virus infection, does not need env (40). Thus, Gypsy can behave both as an infectious retrovirus and as an active retrotransposon (13,14).
A high level of Gypsy transposition might be deleterious for the host genome due to insertional mutagenesis, especially because Gypsy carries a strong DNA insulator (41), which can disrupt the activity of the genes, into which it is integrated by blocking the interactions of distal enhancers with the target promoter. Thus, the inability of Gypsy to extensively invade the genome is conditioned by the cell capacity to repress this retroelement. This control results in reduced steady state levels of Gypsy transcripts (42,43). Moreover, it has recently been shown that synthesis of Gypsy Gag is strictly controlled at the translational level (44).
To understand the dual nature of the D.melanogaster Gypsy and the fact that it appears to be at the frontier between retrotransposons of yeast and simple vertebrate retroviruses, we investigated Gypsy replication in vitro and in cell culture. First, we searched for a NC-like region in Gypsy Gag with all the properties of a bona fide retroviral RNA chaperone protein (45) [reviewed in (3,4)]. To this end, we used a computer-assisted search to look for a peptide domain of low complexity, rich in proline and basic residues, and with a predicted disordered state (3335). Such a peptide domain, named G-NC, was found at the C-terminal end of the Gypsy Gag, showing notable similarities with the NC-like domain of TY1 Gag (Figures 1 and 2). In fact, the Gypsy NC-like peptide was active in the formation of high molecular weight nucleoprotein complexes and in replication primer annealing to the genomic PBS in a manner very similar to that of the C-terminal Gag peptide of yeast TY1 (TYA1-D; Figures 4 and 6). Like other retroviral NC proteins, the G-NC peptide was found to possess general RNA chaperoning properties in vitro, which can promote profound rearrangements of nucleic acid conformation [reviewed in (27,34)]. Along this line, the optimal chaperoning activity of G-NC takes place at a peptide to nucleic acid molar ratio of one peptide per 6 to 10 nt (see Figure 6) as holds true for retroviral NC proteins and NC of the yeast TY3 retrotransposon (27,34,45). Interestingly, NCp9 of TY3 was found to be active in the Gypsy system (data not shown) whereas the basic MLV and HIV-1 NC peptides were poorly active (Figures 4 and 6) although they contain zinc fingers shown to specify direct NCRNA interactions in HIV and MLV (3,24,29). The primary structure of the Gypsy Gag and the presence of an active RNA chaperoning domain at its C-terminus suggest that the Gypsy Gag resembles more that of an ancient retrotransposon than the canonical Gag of the gammaretrovirus MLV, formed of the well-defined matrix, capsid and NC domains. On the opposite the Gypsy genomic RNA has long structured untranslated regions, the 5'- and 3'-untranslated regions (UTRs) (Figure 3) similar to the MLV genomic RNA. In addition, the Gypsy 5'-UTR directs translation of Gag and Env via specific internal ribosome entry sites (IRES) that resemble the MLV Gag and Env IRESes (44,46,47).
Second, we characterized two distinct PBSs located at the 5' and 3' ends of the Gypsy genomic RNA (Figure 5), which are reminiscent of those found in the yeast TY3 retrotransposon (7). The G-NC peptide promoted the annealing of primer tRNALys,2 to both the 5' and 3' PBSs (Figure 6). Furthermore, the simultaneous annealing of primer tRNALys,2 to these two PBSs (Figure 7) resulted in the formation of a 5'3' RNA complex, indicating that a tRNA bridge can possibly generate a circular Gypsy RNA as proposed for the TY3 RNA (7). However, Gypsy differs from TY3 since the 3' PBS is not implicated in the process of cDNA synthesis in vitro and ex vivo (Figures 8 and 9). Yet the exact role of the Gypsy 3' PBS could be at the level of genome maintenance or translation via formation of a circular RNA. This is presently under investigation.
In conclusion, these findings on the NC-like domain of Gypsy Gag and on the existence of two PBSs indicate that Gypsy resembles active retrotransposons and is distinct from canonical simple retroviruses, such as the MLVs and avian leukosis viruses. In agreement with this conclusion, the env-independent reverse transcription of Gypsy in D.hydei cells (Figure 9) is reminiscent of the fact that the efficiency of Gypsy replication in D.melanogaster females was not affected by the frameshift disruption of the env gene (40). On the other hand, the presence of a single 5' PBS necessary for cDNA synthesis (Figures 8 and 9), of long structured UTRs, of functional IRESes and Env, and the fact that cell-free Gypsy particles are infectious (13,14) indicate that Gypsy should be considered as an ancient simple retrovirus, similar to the gammaretrovirus MLV. To investigate how much the NC functions are conserved from Drosophila Gypsy to the MLV, substituting MLV-NC by the Gypsy NC-like is now in progress using MLV-based vectors.
| SUPPLEMENTARY DATA |
|---|
|
|
|---|
Supplementary Data are available at NAR Online.
| ACKNOWLEDGEMENTS |
|---|
The authors thank Marc Ruff (Strasbourg) for helpful advice on peptide expression and purification procedures. Thanks are due to Damien Ficheux (IBCP CNRS) for TYA1-D, MLV-NC and HIV-1 NC peptide synthesis and purification. Gag mutant plasmids were generated by Emeline Sarot with the technical assistance of Geneviève Payen-Groschêne. Work supported by CNRS, ANRS and INSERM to J.L.D., by ARC to A.P. and by CNRS to A.B. R.I.N. is a recipient of an ANRS pre-doctoral fellowship. Funding to pay the Open Access publication charges for this article was provided by ANRS (Agence Nationale de recherches sur le SIDA).
Conflict of interest statement. None declared.
| REFERENCES |
|---|
|
|
|---|
- Boeke, J.D. and Stoye, J.P. (1997) Retrotransposons, endogenous retroviruses, and the evolution of retroelements In Coffin, J.M., Hughes, S.H., Varmus, H.E. (Eds.). Retroviruses, Cold Spring Harbor, NY Cold Spring Harbor Laboratory Press pp. 343435 .
- Kazazian, H.H., Jr. (2004) Mobile elements: drivers of genome evolution Science, 303, 16261632
[Abstract/Free Full Text] . - Darlix, J.L., Lapadat-Tapolsky, M., de Rocquigny, H., Roques, B.P. (1995) First glimpses at structure-function relationships of the nucleocapsid protein of retroviruses J. Mol. Biol, . 254, 523537[CrossRef][ISI][Medline] .
- Darlix, J.L., Cristofari, G., Rau, M., Pechoux, C., Berthoux, L., Roques, B. (2000) Nucleocapsid protein of human immunodeficiency virus as a model protein with chaperoning functions and as a target for antiviral drugs Adv. Pharmacol, . 48, 345372[Medline] .
- Rein, A., Henderson, L.E., Levin, J.G. (1998) Nucleic-acid-chaperone activity of retroviral nucleocapsid proteins: significance for viral replication Trends Biochem. Sci, . 23, 297301[CrossRef][ISI][Medline] .
- Friant, S., Heyman, T., Wilhelm, M.L., Wilhelm, F.X. (1996) Extended interactions between the primer tRNAi(Met) and genomic RNA of the yeast Ty1 retrotransposon Nucleic Acids Res, . 24, 441449
[Abstract/Free Full Text] . - Gabus, C., Ficheux, D., Rau, M., Keith, G., Sandmeyer, S., Darlix, J.L. (1998) The yeast Ty3 retrotransposon contains a 5'-3' bipartite primer-binding site and encodes nucleocapsid protein NCp9 functionally homologous to HIV-1 NCp7 EMBO J, . 17, 48734880[CrossRef][ISI][Medline] .
- Cristofari, G., Bampi, C., Wilhelm, M., Wilhelm, F.X., Darlix, J.L. (2002) A 5'-3' long-range interaction in Ty1 RNA controls its reverse transcription and retrotransposition EMBO J, . 21, 43684379[CrossRef][ISI][Medline] .
- Kirchner, J. and Sandmeyer, S. (1993) Proteolytic processing of Ty3 proteins is required for transposition J. Virol, . 67, 1928
[Abstract/Free Full Text] . - Orlinsky, K.J. and Sandmeyer, S.B. (1994) The Cys-His motif of Ty3 NC can be contributed by Gag3 or Gag3-Pol3 polyproteins J. Virol, . 68, 41524166
[Abstract/Free Full Text] . - Merkulov, G.V., Swiderek, K.M., Brachmann, C.B., Boeke, J.D. (1996) A critical proteolytic cleavage site near the C terminus of the yeast retrotransposon Ty1 Gag protein J. Virol, . 70, 55485556
[Abstract/Free Full Text] . - Cristofari, G., Ficheux, D., Darlix, J.L. (2000) The Gag-like protein of the yeast Ty1 retrotransposon contains a nucleic acid chaperone domain analogous to retroviral nucleocapsid proteins J. Biol. Chem, . 275, 1921019217
[Abstract/Free Full Text] . - Kim, A., Terzian, C., Santamaria, P., Pelisson, A., Prud'homme, N., Bucheton, A. (1994) Retroviruses in invertebrates: the gypsy retrotransposon is apparently an infectious retrovirus of Drosophila melanogaster Proc. Natl Acad. Sci. USA, . 91, 12851289
[Abstract/Free Full Text] . - Song, S.U., Gerasimova, T., Kurkulos, M., Boeke, J.D., Corces, V.G. (1994) An env-like protein encoded by a Drosophila retroelement: evidence that gypsy is an infectious retrovirus Genes Dev, . 8, 20462057
[Abstract/Free Full Text] . - Bayev, A.A., Jr, Lyubomirskaya, N.V., Dzhumagaliev, E.B., Ananiev, E.V., Amiantova, I.G., Ilyin, Y.V. (1984) Structural organization of transposable element mdg4 from Drosophila melanogaster and a nucleotide sequence of its long terminal repeats Nucleic Acids Res, . 12, 37073723
[Abstract/Free Full Text] . - Marlor, R.L., Parkhurst, S.M., Corces, V.G. (1986) The Drosophila melanogaster gypsy transposable element encodes putative gene products homologous to retroviral proteins Mol. Cell. Biol, . 6, 11291134
[Abstract/Free Full Text] . - Barat, C., Le Grice, S.F.J., Darlix, J.L. (1991) Interaction of HIV-1 reverse transcriptase with a synthetic form of its replication primer, tRNALys,3 Nucleic Acids Res, . 19, 751757
[Abstract/Free Full Text] . - Cavarec, L., Jensen, S., Heidmann, T. (1994) Identification of a strong transcriptional activator for the copia retrotransposon responsible for its differential expression in Drosophila hydei and melanogaster cell lines Biochem. Biophys. Res. Commun, . 203, 392399[CrossRef][ISI][Medline] .
- de Rocquigny, H., Ficheux, D., Gabus, C., Fournie-Zaluski, M.C., Darlix, J.L., Roques, B.P. (1991) First large scale chemical synthesis of the 72 amino acid HIV-1 nucleocapsid protein NCp7 in an active form Biochem. Biophys. Res. Commun, . 180, 10101018[CrossRef][ISI][Medline] .
- Barat, C., Lullien, V., Schatz, O., Keith, G., Nugeyre, M.T., Gruninger-Leitch, F., Barre-Sinoussi, F., Le Grice, S.F., Darlix, J.L. (1989) HIV-1 reverse transcriptase specifically interacts with the anticodon domain of its cognate primer tRNA EMBO J, . 8, 32793285[ISI][Medline] .
- Darlix, J.L., Vincent, A., Gabus, C., de Rocquigny, H., Roques, B. (1993) Trans-activation of the 5' to 3' viral DNA strand transfer by nucleocapsid protein during reverse transcription of HIV1 RNA C. R. Acad. Sci. III, . 316, 763771[Medline] .
- Allain, B., Lapadat-Tapolsky, M., Berlioz, C., Darlix, J.L. (1994) Transactivation of the minus-strand DNA transfer by nucleocapsid protein during reverse transcription of the retroviral genome EMBO J, . 13, 973981[ISI][Medline] .
- Covey, S.N. (1986) Amino acid sequence homology in gag region of reverse transcribing elements and the coat protein gene of cauliflower mosaic virus Nucleic Acids Res, . 14, 623633
[Abstract/Free Full Text] . - Mely, Y., Piemont, E., Sorinas-Jimeno, M., de Rocquigny, H., Jullian, N., Morellet, N., Roques, B.P., Gerard, D. (1993) Structural and dynamic characterization of the aromatic amino acids of the human immunodeficiency virus type I nucleocapsid protein zinc fingers and their involvement in heterologous tRNA(Phe) binding: a steady-state and time-resolved fluorescence study Biophys. J, . 65, 15131522
[Abstract/Free Full Text] . - Maurer, B., Bannert, H., Darai, G., Flugel, R.M. (1988) Analysis of the primary structure of the long terminal repeat and the gag and pol genes of the human spumaretrovirus J. Virol, . 62, 15901597
[Abstract/Free Full Text] . - Peterson-Burch, B.D. and Voytas, D.F. (2002) Genes of the Pseudoviridae (Ty1/copia retrotransposons) Mol. Biol. Evol, . 19, 18321845
[Abstract/Free Full Text] . - Cristofari, G. and Darlix, J.L. (2002) The ubiquitous nature of RNA chaperone proteins Prog. Nucleic Acid Res. Mol. Biol, . 72, 223268[ISI][Medline] .
- Dunker, A.K., Lawson, J.D., Brown, C.J., Williams, R.M., Romero, P., Oh, J.S., Oldfield, C.J., Campen, A.M., Ratliff, C.M., Hipps, K.W., et al. (2001) Intrinsically disordered protein J. Mol. Graph. Model, 19, 2659[CrossRef][ISI][Medline] .
- Summers, M.F., Henderson, L.E., Chance, M.R., Bess, J.W., Jr, South, T.L., Blake, P.R., Sagi, I., Perez-Alvarado, G., Sowder, R.C., III, Hare, D.R., et al. (1992) Nucleocapsid zinc fingers detected in retroviruses: EXAFS studies of intact viruses and the solution-state structure of the nucleocapsid protein from HIV-1 Protein Sci, . 1, 563574[Abstract] .
- Demene, H., Jullian, N., Morellet, N., de Rocquigny, H., Cornille, F., Maigret, B., Roques, B.P. (1994) Three-dimensional 1H NMR structure of the nucleocapsid protein NCp10 of Moloney murine leukemia virus J. Biomol. NMR, 4, 153170[ISI][Medline] .
- Morellet, N., de Rocquigny, H., Mely, Y., Jullian, N., Demene, H., Ottmann, M., Gerard, D., Darlix, J.L., Fournie-Zaluski, M.C., Roques, B.P. (1994) Conformational behaviour of the active and inactive forms of the nucleocapsid NCp7 of HIV-1 studied by 1H-NMR J. Mol. Biol, . 235, 287301[ISI][Medline] .
- Namba, K. (2001) Roles of partly unfolded conformations in macromolecular self-assembly Genes Cells, 6, 112[Abstract] .
- Tompa, P. and Csermely, P. (2004) The role of structural disorder inthe function of RNA and protein chaperones FASEB J, . 18, 11691175
[Abstract/Free Full Text] . - Ivanyi-Nagy, R., Davidovic, L., Khandjian, E.W., Darlix, J.L. (2005) Disordered RNA chaperone proteins: from functions to disease Cell. Mol. Life Sci, . 62, 14091417[CrossRef][ISI][Medline] .
- Obradovic, Z., Peng, K., Vucetic, S., Radivojac, P., Brown, C.J., Dunker, A.K. (2003) Predicting intrinsic disorder from amino acid sequence Proteins, 53, 566572[CrossRef][ISI][Medline] .








