Published online 10 May 2006
Article |
THUMP from archaeal tRNA:m22G10 methyltransferase, a genuine autonomously folding domain
1 CEA VALRHO, DSV-DIEPSBTN, Service de Biochimie post-génomique & Toxicologie Nucléaire F-30207 Bagnols-sur-Cèze, France 2 Laboratoire d'Enzymologie et Biochimie Structurales, CNRS Bld 34, avenue de la Terrasse 1, F-91198 Gif-sur-Yvette, France 3 Laboratory of Bioinformatics and Protein Engineering, International Institute of Molecular and Cell Biology Trojdena 4, 02-109, Warsaw, Poland 4 Faculty of Mathematics and Information Science, Warsaw University of Technology Warsaw, Poland
*To whom correspondence should be addressed at CEA VALRHO, DSV-DIEPSBTN, Service de Biochimie post-génomique & Toxicologie Nucléaire, Marcoule, BP 17171, F-30207 Bagnols-sur-Cèze cedex, France. Tel: 33 4 66 79 68 02; Fax: 33 4 66 79 19 05; Email: armengaud{at}cea.fr
Received January 13, 2006. Revised February 13, 2006. Accepted March 16, 2006.
| ABSTRACT |
|---|
|
|
|---|
The tRNA:m22G10 methyltransferase of Pyrococus abyssi (PAB1283, a member of COG1041) catalyzes the N2,N2-dimethylation of guanosine at position 10 in tRNA. Boundaries of its THUMP (THioUridine synthases, RNA Methyltransferases and Pseudo-uridine synthases)containing N-terminal domain [1152] and C-terminal catalytic domain [157329] were assessed by trypsin limited proteolysis. An inter-domain flexible region of at least six residues was revealed. The N-terminal domain was then produced as a standalone protein (THUMP
) and further characterized. This autonomously folded unit exhibits very low affinity for tRNA. Using protein fold-recognition (FR) methods, we identified the similarity between THUMP
and a putative RNA-recognition module observed in the crystal structure of another THUMP-containing protein (ThiI thiolase of Bacillus anthracis). A comparative model of THUMP
structure was generated, which fulfills experimentally defined restraints, i.e. chemical modification of surface exposed residues assessed by mass spectrometry, and identification of an intramolecular disulfide bridge. A model of the whole PAB1283 enzyme docked onto its tRNAAsp substrate suggests that the THUMP module specifically takes support on the co-axially stacked helices of T-arm and acceptor stem of tRNA and, together with the catalytic domain, screw-clamp structured tRNA. We propose that this mode of interactions may be common to other THUMP-containing enzymes that specifically modify nucleotides in the 3D-core of tRNA. | INTRODUCTION |
|---|
|
|
|---|
After their transcription, tRNA precursors are subjected to numerous post-transcriptional modifications. To date, out of 102 chemically distinct modified nucleosides presently known in all types of RNA, 87 have been identified in tRNA [(1), see also http://medlib.med.utah.edu/RNAmods/ and http://genesilico.pl/modomics/]. Methylation at different positions of bases and/or of the 2'-hydroxyl group of riboses are the most frequently encountered ones. These modifications can alter the tRNA's codon specificity or stabilize the tRNA tertiary structure [reviewed in (2) and several chapters in (3)], but significance of many tRNA modifications only begins to be understood [see several chapters in (4)]. Concerning tRNA modification enzymes, several have been identified over the last decade, mostly from Escherichia coli, Saccharomyces cerevisiae and also a few from Archaea (57). Remaining uncharacterized enzymes are now systematically studied after identification by comparative genomics and/or structural genomics approaches [see for examples (812)].
Most enzymes involved in RNA metabolism are conserved multi-domain proteins: beside a catalytic domain carrying out the enzymatic reaction, they often require one or several other domains to recognize and possibly help to bind the RNA substrate. These domains also may help to bind other macromolecules thus forming multi-subunits ribonucleoprotein complexes (13). Among these maturation enzymes, RNA methyltransferases (MTases) have been reported to comprise a catalytic domain that belongs to a limited number of well-studied enzyme superfamilies (10) and one or several additional variable domains, such as domain S4, PUA, TRAM, THUMP, NusB, OB-fold and wHTH (14), which are supposed, but not always experimentally tested, to be involved in binding of nucleic acids. While most studies focused on the catalytic domains of tRNA modification enzymes [see for examples refs (1518)], only in rare cases their putative RNA-binding domains have been characterized biochemically and structurally (19,20).
Recently, we reported the characterization of PAB1283 protein from the archaeon Pyrococcus abyssi, a prototype member of COG1041. This enzyme catalyzes the N2,N2-dimethylation of guanosine at position 10 in archaeal tRNAs and was previously called Trm-G10 (9,21). It is hereby designated TrMet(m2,2G10) according to a newly developed, uniform nomenclature (7). Enzymes belonging to COG1041 are ubiquitous in Eukaryota and Archaea but are not present in Bacteria (9,22). In their C-terminus, they all exhibit a characteristic Rossmann fold, S-adenosylmethionine-dependent MTase domain (pfam01170) and in their N-terminus, a predicted RNA-binding THUMP domain (abbreviated after THioUridine synthases, RNA MTases and Pseudo-uridine synthases (23); pfam02926). As implied by its name, THUMP domain is present in many families of enzymes that catalyze very diverse reactions on tRNA. For example, ThiI (COG0301) from E.coli is involved in 4-thiouridine formation at position 8 of some bacterial tRNAs (2426) and Tan1 (KOG3943, related to COG1818) from S.cerevisiae was reported to be required for N4-acetylcytidine formation at position 12 in tRNAs harbouring a long extra arm (27). Other THUMP-containing proteins, COG1258 (a tRNA pseudouridylate synthase; Martine Roovers and Louis Droogmans, personal communication) and COG0116 (predicted as MTase), are still uncharacterized. Therefore, THUMP that is present in proteins of the three domains of life, is an ancient module, which probably has been recruited during evolution to act in different processes related to tRNA modification.
Recently, the structures of two ThiI orthologs (members of COG0301) have been solved: that of PH1313 from Pyrococcus horikoshii [1vbk in the Protein Data Bank; unpublished analysis by M. Sugahara, and N.Kunishima, the RIKEN structural genomics initiative) and BA4899 from Bacillus anthracis strain Ames (2c5s, (28)]. Both structures are composed of a C-terminal PP-loop domain that contains the thiolase active site (probably degenerated in PH1313) and a N-terminal predicted RNA-binding module comprising the THUMP domain [as defined in its minimal form by Aravind and Koonin (23)], closely linked with a N-terminal ferredoxin-like domain (NFLD) (28). Waterman et al. (28) suggested that the NFLD domain may be specific to ThiI.
Despite the widespread occurrence and presumed importance of the THUMP domain, no experimentally proven function has yet been assigned to it. Recently, we proposed that THUMP may interact with a specific region of tRNA and target the catalytic domains of various enzymes towards the central 3D-core of the tRNA molecule (9). This hypothesis was based on the fact that three well characterized THUMP-containing proteins, ThiI, Tan1 and TrMet(m2,2G10), are all involved in site-specific modification within the same region of the L-shaped tRNA substrate: positions 8, 12 and 10, respectively. In order to obtain better insight into the structural and functional features of the THUMP domain and the TrMet(m2,2G10) variant of its N-terminal extension, we first delineated the boundaries of domains in PAB1283 and then purified the N-terminal region as a standalone protein [1155 aa, including the THUMP domain (59139 aa) as initially defined by Aravind and Koonin (23)]. We found that this N-terminal fragment of PAB1283 (here termed THUMP
) is autonomously folded and exhibits only a very low affinity for tRNA. We propose a structural model based on protein fold-recognition analysis, which we then validate experimentally using chemical modification of surface-exposed residues and identification of an intramolecular disulfide bridge. Our results suggest that the THUMP
fragment of PAB1283 assumes a similar structure to that of the N-terminal fragment of ThiI, i.e. that it contains two interlinked
/ß subdomains [the NFLD (sub)domain and the classical THUMP domain]. Finally, we constructed a docking model of the whole PAB1283 enzyme onto yeast tRNAAsp (a genuine substrate of PAB1283) based on experimental restraints from our previous work on the elucidation of the identity elements in tRNA required for dimethylation of G10 in tRNA (21). Our model suggests a potential binding mode for the THUMP domain, which may be common to various RNA modification enzymes that specifically modify nucleotides in the 3D-core of the tRNA molecule.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Limited trypsin proteolysis of PAB1283 and THUMP
proteinsProteolysis reactions were carried out in 25 mM TRIS/HCl buffer, pH 8.0, containing 200 mM NaCl and 1 mM DTT at 25°C for 60180 min using different protease/polypeptide ratio [1:5 and 1:2 (w/w)]. The protein concentrations were 0.54 mg/ml for PAB1283 and 1.23 mg/ml for THUMP
. The reactions were stopped by addition of 4 mM 4-(2-aminoethyl)-benzene-sulfofluoride (a Ser-protease inhibitor, Pefabloc SC from Pentafarm). The reaction mixtures were directly analyzed by Matrix Assisted Laser Desorption Ionization-Time Of Flight (MALDI-TOF) mass spectrometry or resolved by SDSPAGE prior fingerprint identification and membrane blotting for Edman sequencing.
Construction of a N-terminal 6His-tagged THUMP
overexpressing plasmid
Two synthetic oligonucleotide primers were designed in order to amplify a truncated version of the PAB1283 gene from P.abyssi using pSBTN-AC18 plasmid (Armengaud et al. (19) as template. These primers are oAJ01 (5'-caccATGTTCTACGTTGAAATCCTAGGTTTGC-3') and oAJ02 (5'-atcaATCGGCCTTCCTCTCGTCAAACTCC-3'). Nucleotides in lower cases were not present in the original coding sequence. PCR performed with Pwo polymerase (Roche Diagnostics) gave a 473 bp homogeneous product that was resolved on a 1.5% GTG agarose gel, purified by means of a QiaexII agarose gel extraction kit (Qiagen) and cloned into pET200 D-TOPO (Invitrogen). The resulting plasmid was sequenced in order to ascertain the integrity of the nucleotide sequence and was named pSBTN-AD55. Thirty-six amino acid residues (MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFT) were introduced with the N-terminal 6His/Xpress-tag from pET200.
Purification of recombinant THUMP
module
Large scale liquid cultures of E.coli Rosetta(DE3)pLysS strain (Novagen) transformed with pSBTN-AD55 were set up at 30°C and induced with 1 mM Isopropyl-ß-D-thiogalactopyranoside (IPTG) as described earlier (29). Cells (63 g of wet material) were resuspended in 315 ml of cold 50 mM Tris/HCl buffer (pH 8.0 at 20°C) containing 500 mM KCl and 10% (w/w) glycerol, disrupted and centrifuged. THUMP
was purified from 80 ml of this cell extract (corresponding to 16 g of wet cells). The sample was subjected to a 20 min heat treatment at 60°C. After centrifugation, the supernatant was diluted with 60 ml of 50 mM Tris/HCl buffer (pH 8.0) containing 500 mM KCl, 10% glycerol (w/w) and 50 mM imidazole (buffer A) and applied onto a 5 ml HiTrap Chelating HP column (Amersham Biosciences) at a flow rate of 1.5 ml/min. After wash with buffer A, the 6His-tagged THUMP
protein was eluted over a 45 ml linear gradient comprising 50300 mM imidazole. The major peak, which eluted at about 180 mM imidazole, was desalted by gel filtration on a G25SF gel (Amersham Biosciences) previously equilibrated with 50 mM Tris/HCl buffer (pH 8.0) containing 20 mM KCl and 10% (w/w) glycerol. Protein concentrations were determined using the molar absorption coefficient of 17 900 M1 cm1 at 280 nm. Determination of native molecular mass and tRNA binding assay by gel filtration were done essentially as described earlier (9).
Circular dichroïsm
Far- and near-ultraviolet (UV) circular dichroïsm spectra were recorded at 25°C on a J-810 Jasco spectropolarimeter equipped with a PTC-424S Jasco Peltier, using a quartz cuvette of 1 mm path length, with a 20 nm/min scanning speed and a band-width of 1 nm. For each sample, three spectra were averaged and corrected from the baseline for buffer solvent contribution. Experimental data were analyzed using the program K2D (http://www.embl-heidelberg.de/~andrade/k2d/).
tRNA gel retardation assay
tRNAs used for band shift assays were transcribed in vitro in presence of [
-32P]CTP to label tRNA as described previously (30). PAB1283 (15 nM to 4 µM) or THUMP
(98 nM to 25 µM) were incubated with 32P-labeled tRNA (10 fmol) in 25 mM Tris-HCl buffer (pH 7.5) containing 50 mM NaCl, 5 mM MgCl2, 10% glycerol, 0.1 mg/ml RNase free BSA, 2 mM DTT in a final volume of 20 µl. After incubation at 25°C for 20 min, the mixture was placed on ice and bromophenol blue was added to a final concentration of 0.05% before loading on a 6% polyacrylamide gel (mono/bis, 37.5:1) containing 5% glycerol and 1 mM EDTA in 45 mM Tris/Boric acid buffer (pH 8.0) at 4°C. After electrophoresis, the gel was dried and analyzed by using a Storm PhosphorImager (Molecular Dynamics) to quantify free and bound tRNA.
Lysine, tyrosine and serine labeling by three NHS ester reagents
Sulfo-N-hydroxysuccinimide-biotin (Sulfo-NHS-Biotin), Sulfo-N-hydroxysuccinimyl-6-(biotin-amido)-hexanoate (Sulfo-NHS-LC-Biotin) and Sulfo-N-hydroxysuccinimyl-6-(biotin-amido)-6-hexanamidohexanoate (Sulfo-NHS-LC-LC-Biotin) were obtained from Pierce. Labeling of one residue by Sulfo-NHS-Biotin, Sulfo-NHS-LC-Biotin or Sulfo-NHS-LC-LC-Biotin, should result in a mass increase of 226.293/226.078 (C10H14O2N2S1), 339.452/339.162 (C16H25O3N3S1) and 452.611/452.246 (C22H36O4N4S1) (average/monoisotopic masses in a.m.u.), respectively. THUMP
modification was performed by incubating 1.66 nmol of protein in 50 mM K2HPO4/KH2PO4 buffer (pH 7.5), 50 mM NaCl, with various amounts of freshly prepared chemical dissolved at 2 mM in the same buffer with a constant protein concentration of 33.2 µM. After 30 min of incubation at room temperature, samples were dialyzed against the same reaction buffer. All samples were desalted by means of ZipTipC18 (Millipore) prior MALDI-TOF analysis. Trypsin proteolysis was carried out for 5 h at 37°C with a trypsin/protein ratio of 1:50 (w/w).
Mass spectrometry
Mass spectra were recorded on a MALDI-TOF Biflex IV mass spectrometer (Bruker Daltonics) in positive ionization mode. The matrix solutions for desalted protein or peptide samples were sinapinic acid prepared as saturated solution in 30% acetonitrile, 70% milli-Q water and 0.1% trifluoroacetic acid and
-cyano-4-hydroxycinnamic acid prepared as one-fourth diluted satured solution in 50% acetonitrile containing 0.1% trifluoroacetic acid, respectively. Spectra of proteins and peptides were acquired in linear mode (150250 laser shots) and reflectron mode (90180 laser shots), respectively. A pepmix calibration kit (Bruker Daltonics) or internal peaks were used for calibration. MALDI mass spectra were processed using the Xmass 5.1.5 software from Bruker Daltonics. Peptide assignment and identification of labeled residues were carried out using the FindMod package from ExPaSy (http://www.expasy.org/tools/findmod/).
Bioinformatic methods
The multiple sequence alignment was carried out using MUSCLE (31) and refined based on the results of structure predictions, to place insertions and deletions in the regions of solvent-exposed loops. Structure prediction was carried out via the GeneSilico metaserver gateway [(32), and references therein]. Access to PONDR was kindly provided by Molecular Kinetics (Indianapolis, IN). A combination of various methods for prediction of secondary structure, protein disorder and residue accessibility was used to predict the local structure, along with a number of protein FR servers to detect the best structural templates in the Protein Data Bank and to align them to the target sequence (i.e. the sequence of the protein to be modeled). The modeling of the 3D structure was done independently for each domain, using the FRankenstein's monster approach (33,34). It consists of iterative cycles comprising the following steps: automatic model-building using MODELLER (35), assessment of the local model quality using the VERIFY3D scoring system (36) via the COLORADO3D engine (37), creation of hybrid models by recombination of consensus fragments with best-scoring non-consensus fragments, inference of a new alignment by superposition of the hybrid model with the template structure, and local modification of the alignment for regions with poor score. The initial pool of models was generated based on raw FR alignments and the cycles of realignment and remodeling were continued until the VERIFY3D score of resulting models could not be improved. 100 models with the best score were retained for experimental validation.
Mapping of the sequence conservation onto the protein sequence was carried out via COLORADO3D (37), using the Rate4Site method (38), with the JTT matrix and the Bayesian model of sequence substitution, based on the alignment of the N-terminal regions of PAB1283 orthologs.
ProteinRNA docking was performed using the Global RAnge Molecular Matching (GRAMM) method (39). In the absence of the scoring function specific for proteinRNA interactions we resorted to the low-resolution docking option of GRAMM that optimizes only the geometric fit of molecular surfaces between the two molecules, without taking into account the energy of interactions, e.g. from electrostatics. Thousand docking solutions were retained for each domain and tested for agreement with the experimental data using the FILTREST3D method for discrimination of models that fulfill distance restraints (J. M. Bujnicki, M. J. Gajda, M. Kaczor and A. Bakulina, manuscript in preparation).
To facilitate reading and future discussions about amino acids of TrMet(m2,2G10) from P.abyssi, position of residues in purified proteins (6HIS-tagged PAB1283 and 6HIS-Xpress-tagged THUMP
proteins) and models refers to the native PAB1283 sequence as defined in (9).
| RESULTS |
|---|
|
|
|---|
FR analyses for THUMP modeling
COG1041 proteins are predicted to be organized in at least two structural domains. Figure 1 shows a sequence alignment of the N-terminal half of some archaeal COG1041 members. As the 60 N-terminal amino acids are notably less conserved (7 identical residues in at least 2/3 of the sequences shown in Figure 1 over 60) than the next 90 aa (14 identical residues over 90), it is difficult to assess if they really belong to the THUMP domain or if they should be considered as a distinct structural domain. Protein FR methods reported with high confidence that the best template for modeling the 155 N-terminal amino acid of PAB1283 is the N-terminal region of PH1313 (1vbk). The recently solved structure of B.anthracis ThiI ortholog (2c5s) has not yet been included in the template libraries of most FR servers and, when reported, gave similar scores compared to 1vbk. The aligned region spanned both subdomains of ThiI orthologs: 176 aa matched the NFLD domain, while 77165 aa matched the minimal THUMP domain. The ß
ßß
ß*
ß
ßßß pattern predicted for the N-terminus of PAB1283 was perfectly aligned with the pattern observed in the crystal structure of PH1313 (* indicates the ß-strand shared by both subdomains). In the sequence alignments between PAB1283 and PH1313 reported by FR servers (compare first and last sequences in Figure 1B), the only regions that were not always similarly aligned are 2565 aa of PAB1283 (the predicted junction between the NFLD and THUMP domains) and 135155 aa (the predicted C-terminus of the THUMP domain, which in PH1313 folds back onto the NFLD). As expected, no similarity was detected between the catalytic domain of PAB1283 and the PP-loop pyrophosphatase domain of ThiI orthologs. We have also independently submitted 158 aa and 59139 of PAB1283 to FR analysis to confirm the presence of two domains in the N-terminal region of PAB1283. While region 77165 was unambiguously aligned to the THUMP domain of PH1313, region 158 could not be confidently aligned to any particular fold, although nearly all templates proposed by FR servers displayed the two-layer
/ß structure, with the ferredoxin-like or a similar fold with the same pattern of secondary structures ß
ßß
ß. This result suggests that, despite the absence of significant sequence similarity (28), 158 aa of PAB1283 are most likely a considerably diverged version of the N-terminal ferredoxin-like fold present in PH1313 and also that this (sub)domain could require the presence of the THUMP core domain for correct folding.
|
Experimental delineation of domain boundaries of PAB1283
In order to discriminate the function of the THUMP domain within the whole PAB1283 methyltransferase, we intended to purify it as a structurally stable standalone polypeptide. We first attempted to identify the precise domain boundaries in PAB1283, using bioinformatic methods available via the GeneSilico metaserver (32). All methods confidently identified 145165 aa as the inter-domain linker region. In particular, this region was predicted to be disordered by PONDR (40) as indicated in Figure 1. Besides, FR methods found residues 150160 to be at the N-terminus of the conserved core of the MTase domain, in agreement with our previously published model (9), while residues 140150 were found to mark the C-terminus of the THUMP domain (see below).
The domain boundaries were then delineated experimentally by subjecting PAB1283 to limited proteolysis. Trypsin was found eminently suitable for pinpointing sites of chain flexibility or local unfolding in between the two domains because 12 arginines and 4 lysines are scattered along the region (128 to 180 aa) encompassing the predicted linker. Figure 2 (left part) shows the fragmentation pattern generated by limited trypsin proteolysis as revealed by SDSPAGE. PAB1283 appears quite refractory to proteolysis as one-third of the sample was still not digested after 180 min incubation, even with 50% (w/w) trypsin, a unusually high ratio (Figure 2, lane 5). Two protein fragments of
20 and 19 kDa (polypeptides C and D in Figure 2, lane 3) were generated after 60 min incubation with 20% (w/w) trypsin. Edman sequencing and MALDI-TOF mass spectrometry showed that PAB1283 is divided into two polypeptides: the almost full-length tagged N-terminus domain (Tag+[1152], 19 kDa) and the full-length C-terminal domain ([157329], 20 kDa) [see Figure 2 (right part) and Supplementary Data]. The trypsin cleavage sites delineate a short interdomain tetrapeptide linker region: [153156]. Under harsh proteolysis conditions, no other stable intermediate could be detected (Figure 2, lane 5). The experimentally determined domain boundaries fit with those predicted from sequence comparisons and disorder predictions. These results confirm the existence of at least two well-defined structural domains in PAB1283 connected by a short solvent-exposed linker. This linker is flexible as it is sensitive to trypsin proteolytic cleavage.
|
Purification of a standalone THUMP
proteinTo confirm that THUMP
is a structurally independent unit, an expression plasmid (pSBTN-AD55) encoding a 6HIS/Xpress-tagged version of the N-terminal module (NFLD+THUMP, residues [1155]) was constructed. The 22 kDa soluble protein, hereby designated THUMP
, was obtained with a high degree of purity (Figure 2, lane 6). THUMP
behaves as a monomeric protein on a Superdex75 column (data not shown), like the native PAB1283 protein (9). The near UV-CD spectrum of this protein (Figure 3) shows typical negative ellipticity signals with minima at 208218 nm. Deconvolution of the CD signal leads to an estimation of the content of secondary structure elements of about 30% of
-helices and 20% of ß-sheets. To further confirm that the protein was not unfolded, it was subjected to limited trypsin proteolysis. As shown in Figure 2 (lanes 6 and 7), a truncated polypeptide of
19 kDa (band F) was identified on SDSPAGE. Edman sequencing and mass measurement of this entity confirmed that only the N-terminal tag is proteolyzed (Supplementary Data). The THUMP
core as defined above, remains quite resistant to further proteolysis, even under the harshest conditions used, as shown in Figure 2 (see lanes 5 and 7). Such proteolysis results are clearly in favor of a well structured and folded THUMP
domain. Thus, we conclude that the N-terminal domain of TrMet(m2,2G10) can fold autonomously.
|
The affinity of THUMP
for tRNA is very lowSince THUMP has been predicted to be a RNA-binding domain (23), we analyzed whether purified recombinant THUMP
could interact with tRNAs. THUMP
was incubated with E.coli bulk tRNAs (or yeast bulk tRNAs) in the same experimental conditions where a 1/1 complex with the full-length recombinant PAB1283 (9) was previously identified. The mixture was subjected to gel filtration on Superdex75 and the elution profile compared to those obtained under identical conditions with the protein or bulk tRNAs alone (data not shown). A new peak of compound eluting faster than that of either THUMP
or tRNAs alone was not observed, indicating no formation of a complex between THUMP
and tRNAs. In order to estimate the affinity of THUMP
for tRNA, we performed tRNA gel retardation assays. Radiolabeled in vitro transcribed tRNA was incubated with increasing amounts of PAB1283 or THUMP
. Similar results were obtained with the two tRNA substrates that were tested: P.abyssi tRNAAsp (data not shown) and yeast tRNAAsp (Figure 4). As shown in Figure 4, one band shift was observed with PAB1283 protein, a result consistent with the formation of a 1/1 complex as indicated by gel filtration assays (9). The dissociation constant (Kd) was estimated at about 1 µM. With THUMP
, the complex is barely detectable even at 25 µM of protein (Figure 4) and this weak interaction can be considered as unspecific. Therefore, THUMP
is not responsible per se for the affinity of TrMet(m2,2G10) for tRNA, although its contribution in the interaction with tRNA in the context of the whole protein can be anticipated.
|
Modeling the 3D-structure of THUMP

We modeled the structure of THUMP
using the FRankenstein's Monster approach. Briefly, we generated alternative models based on different alignments between the region 1155 of PAB1283 and the region 1175 of PH1313 from P.horikoshii and BA4899 from B.anthracis strain Ames. Then, we assessed the local sequence-structure fit in the models using VERIFY3D (41), and iteratively recombined the models and locally shifted the alignments to generate new models with improved VERIFY3D score. The shifts in the alignments were constrained to maintain the overlap of identical secondary structure patterns in PAB1283 and PH1313/BA4899 (ThiI). As a result, we obtained a number of relatively similar models of THUMP
,which differed mainly in the conformation of the variable loops (e.g. residues 711, 8084, 9297 and 113117) and orientation of the side-chains (see below). The root mean square deviation (RMSD) between the models ranged from <1 Å (models based on very similar alignments, with differences limited to loops) to 4.5 Å (models based on significantly different alignments).
Validation of the THUMP
3D-structural model by chemical modification and mass spectrometry
To validate the models and identify the variant with the best conformation, we attempted to determine, which residues are accessible to labeling reagents using mass spectrometry measurements. The amino groups of Lys and the N-terminal Met, as well as Ser and Tyr hydroxyl groups, were specifically labeled with Sulfo-NHS-biotin. After reaction with the chemical reagent, samples were subjected to trypsin proteolysis and compared to untreated samples by MALDI-TOF mass spectrometry. The coverage of the THUMP
sequence was estimated to be 80% with two lysine residues (Lys19 and one amino acid from the tag) not included in this coverage. To unequivocally confirm the assignment of modified peptides, we labeled in separate assays THUMP
with two other reagents (Sulfo-NHS-LC-biotin and Sulfo-NHS-LC-LC-biotin), exhibiting the same overall reactivity but introducing mass differences (+113.084 a.m.u.) due to their spacer arm lengths. As shown in Table 1, peptide assignment of a majority of ions is clearly redundant and confirmed by the theoretical mass increment observed for each modified peptides. Besides three residues from the tag, nine reactive residues were unambiguously labeled and are therefore solvent accessible: Lys30, Lys79, Lys83, Lys90, Lys105, Lys122, Tyr130, Lys134, Lys147 and Lys153 (Table 1). The labeling of Tyr34, Tyr56, Lys101 and Lys128 was not observed under these experimental conditions, although the native peptides encompassing these residues were clearly detected.
|
During the biochemical study of THUMP
, we observed the presence of an additional discrete band on SDSPAGE at 22 kDa under non-reducing conditions, migrating slightly faster than the main protein band (See Supplementary Data). This additional band was not detected when the sample was treated with DTT prior to electrophoresis. This indicates that an intra-polypeptide disulfide bridge can be formed in THUMP
. Hence, the two cysteines (Cys96 and Cys131) present in THUMP
are likely to be close in the 3D structure. These two cysteines are conserved among the four TrMet(m2,2G10) sequences from Thermococcales (See Figure 1). As disulfide bridges are often present in hyperthermophilic proteins because of their stabilizing effects (42,43), the disulfide bridge is probably formed in PAB1283.
Identification of the THUMP
model that minimizes the violation of experimental constraints
The accessibility characteristics of several amino acids determined by NHS-biotin labeling as well as the predicted close distance of Cys96 and Cys131 (Cß atoms <7 Å) were used as constraints to select between 100 alternative models. However, no model was found to fully agree with all data. Only one constraint was violated in all models: the
-amino group of Lys101 was always exposed to the solvent, despite it was never found to be labeled. Besides, in all but two models (very similar to each other, RMSD only 1 Å), the
-amino group of Lys90 was buried in the protein core, despite we found that it can be labeled. Figure 5 shows one of the two best models. Its RMSD to the template structures 1vbk and 2c5s is 1.8 and 3.9 Å over all alignable pairs or residues. The larger value of RMSD to 2c5s results from a slightly different angle between the NFLD and THUMP domains in 1vbk and 2c5s. Inspection of these two models reveals that the side-chain of Lys101 is close to the side-chain of Glu104 (and in fact, the orientation of these residues is very similar in all models). Perhaps the formation of a salt bridge between these residues prevents the labeling of Lys101 (44,45). In the immediate neighborhood of these residues, the side-chains of Lys90 and Lys105 are partially solvent-exposed, and do not form any salt bridges, in agreement with their labeling. In the rejected models, Lys90 was found at the same position, but with the side-chain inserted into the hydrophobic core. Finally, it is satisfying to find that the distance constraint is respected as the side-chains of Cys96 and Cys131 are close to each other (Cß atoms at 4.9 Å) allowing them to form an intramolecular disulfide bridge.
|
Summarizing, the overall structure of THUMP
in solution is predicted to resemble the N-terminal region of PH1313 in the crystal, i.e. to contain two closely interlinked
/ß domains with the ferredoxin-like and THUMP fold, respectively. The interface of both subdomains includes a common hydrophobic ß-strand that spans both domains (Figure 5A). Thus, in agreement with the data from the limited proteolysis experiments, both subdomains of THUMP
are predicted to be linked very rigidly and to form a single independently folded unit. Mapping of the sequence conservation onto the surface of the THUMP
model reveals specific clustering of conserved residues from both subdomains (e.g. Glu5, Leu7 (conserved as Ser in most members of COG1041), His54, Arg89, Lys128, Arg152) on one side of the molecule, which we predict to be involved in tRNA binding (Figure 5B). On the other hand, mapping of the electrostatic potential reveals no particular concentration of positive charge (data not shown).
Prediction of the PAB1283:tRNA complex structure
The availability of experimentally validated models of the C-terminal catalytic domain (9) and the N-terminal domain (this work) of PAB1283, as well as data concerning the regions of tRNA that are involved in the enzyme recognition (21), allows us to speculate about a reasonable model of interactions between PAB1283 and tRNA, using as substrate the bona fide yeast tRNAAsp. This tRNA was shown to form a 1:1 complex with the archaeal enzyme and is efficiently methylated in the presence of S-adenosylmethionne (9). The field of computational proteinRNA docking is in its infancy and there are no established algorithms to carry out this type of modeling. In particular, there are no confident methods to account for the flexibility of the RNA molecule, as well as to precisely calculate the energy of RNAprotein interactions, which are often dominated by electrostatics. Thus, we decided to use the GRAMM software for low-resolution docking (39) to calculate independently for each domain 1000 alternative docked models to the yeast tRNAAsp structure [PDB entry 2tra
[PDB]
, (46)] that simply exhibit surface complementarities but no requirement for electrostatic compatibility was imposed. We assumed that no major conformational rearrangements occur in the RNA or the protein, except for possible base-flipping of G10/m2G10 or conformational changes of the flexible linker between THUMP
and the catalytic domain of PAB1283. Subsequently, we screened all the models for the following constraints, based on experimental data. (i) The C-terminal MTase domain must be positioned in such a way that the methylated nucleoside G10 can be accommodated in the catalytic pocket. Thus, we screened for docking solutions in which the N2 group of G10 in tRNA was within 15 Å from the C-ß atom of the catalytic side-chain D254 (9), the distance threshold being deliberately large to account for possible base-flipping of G10). (ii) The T-arm is the key determinant of specificity of interactions between PAB1283 and tRNA, and the amino acid acceptor stem is required for the second round of methylation (to m22G10) to occur (21). Thus, we looked for such docking solutions, in which any of the atoms from either domain of PAB1283 is within 5 Å from both any atoms of nucleosides 4965 (T-arm) and 17 or 6672 (acceptor arm) in the tRNAAsp. (iii) The C-terminus of THUMP
is covalently joined to the N-terminus of the catalytic domain. Thus, we looked for such combinations of docking solutions that passed conditions 1 and 2, in which aa 153 in the N-terminal domain was within 50 Å from aa 167 in the C-terminal domain (the distance threshold was deliberately large to account for the flexibility of the linker). (iv) Last, but not least, THUMP
and the catalytic domain must not overlap spatially.
Among the 1000 docking models obtained for each domain (100 000 0 possible combinations), only five models of the N-terminal domain and two models of the C-terminal domain passed all criteria. Interestingly, in the case of the C-terminal domain, conditions 1 and 2 turned out to be mutually exclusive, i.e. we found no models, which would simultaneously bind to the T-arm and position the catalytic pocket in the vicinity of the nucleoside to be methylated. Hence, we predict that binding of the T-arm occurs through the N-terminal THUMP
domain. Among the five docking solutions for the N-terminal region, only two similar models (RMSD 5.7 Å) interact with the T-arm using the conserved side of the molecule, while the three others (dissimilar to each other) do not make any contacts with the conserved protein residues. Thus, we introduced a 5th, ad hoc criterion to retain only the models that interact with the tRNA using the conserved residues. The two selected models of the C-terminal domain approach tRNA from the same side, albeit they are rotated with respect to each other by nearly 180°.
We analyzed the conservation of nucleotides in Archaeal tRNAs with the m22G10 modification in close contact with THUMP
and found no common features except the G53C61 pair (which is important for the tRNA folding) and the CCA extension. Analysis of the docking model reveals that the THUMP
module of TrMet(m2,2G10) makes contacts with C61 through residues from the region 145148 (Arg145 and Lys147 in PAB1283, see Supplementary Data). This region is not strongly conserved on the level of the amino acid sequence in TrMet(m2,2G10) orthologs, but always contains at least one positively and one negatively charged residue that may be important for binding either to the base or to the backbone (the phosphate is exposed). The stacking of the G53C61 base pair over the U/T54-A58 reverse-Hoogsteen base pair in trans induces a characteristic bulged-out conformation of the 59 and 60 nt (4749) that are not found here in contacts with the THUMP
module. As no other conserved nucleotides belong to the tRNA region predicted to be in contact with the THUMP
module, the conserved geometry of the T-loop and acceptor stem may be the most important element for recognition by the enzyme.
Figure 6 shows the superposition of tRNAAsp and the docking solutions that fulfill the imposed constraints. Together, they form a fuzzy model of PAB1283-tRNA interactions, which should not be interpreted at the atomic level, but provides the first educated guess of the mutual localizations of domains from the enzyme and the substrate molecule. This docking model is compatible with the scheme that the two structural domains of TrMet(m2,2G10) are sideways the central 3D-core of tRNA.
|
| DISCUSSION |
|---|
|
|
|---|
The existence of a new putative RNA-binding domain, abbreviated THUMP, was deduced from sequence comparison of various proteins known or predicted to be involved in RNA metabolism (23). For a long time, the THUMP domain remained essentially uncharacterized. Recently, new experimental data have been collected on three different THUMP-containing enzymes: ThiI from E.coli, Tan1 from S.cerevisiae and TrMet(m2,2G10) from P.abyssi. All three proteins are involved in tRNA modification and target nucleosides in the central 3D-core of the tRNA molecule. Thus, we proposed that THUMP may interact with a specific region of tRNA and target the catalytic domains of these various enzymes towards the common region of the substrate (9). Recently, two structures of ThiI family members have been solved: PH1313 from P.horikoshii (without any published analysis) and BA4899 from B.anthracis strain Ames (28). However, none of these proteins have been biochemically characterized and actually their activity remains putative [PH1313 is even predicted to be catalytically inactive, (28)]. Thus, the experimental validation that THUMP interacts with tRNA and can be called a RNA-binding domain was needed.
In this paper, we first defined by limited proteolysis and mass spectrometry the boundaries of domains in PAB1283, a prototype member of the TrMet(m2,2G10) family. We then purified the N-terminal region [1155] of PAB1283, which contains the THUMP domain, as a standalone protein. This autonomously folding unit was characterized as a soluble monomeric protein showing only a very weak affinity for tRNA in contrast to the entire PAB1283 protein.
In order to gain insight into the structure of this domain and understand how it functions concomitantly with the C-terminal catalytic domain, we proposed an original modeling approach. It is now well established that in silico modeling can be a fast approach to predict the structure of a protein or a macromolecular complex. However, theoretical methods generate models that need experimental validation, and also the number and diversity of the proposed solutions is often considerable. A promising strategy is the use of experimental data for model discrimination or refinement (50,51). Thus, we combined the experimental and theoretical analyses at three stages, corresponding to characterization of the primary structure (domain boundaries in the PAB1283 sequence), tertiary structure (3D fold of the THUMP
module), and quaternary structure (interactions between the two protein domains and the tRNA). First, it is satisfying to find that the experimentally determined boundaries of both domains from PAB1283 parallel those predicted by our FR analysis. Second, to distinguish among various threading models of THUMP
, we determined which residues are solvent accessible with a set of three labeling reagents and identified a disulfide bridge between the two cysteines found in the THUMP
sequence. These constraints allowed us to validate the hypothesis that the N-terminal structural module of PAB1283 is related to the equivalent module observed in the structure of ThiI (28), and that both proteins share not only the easily detectable THUMP domain, but also the strongly diverged NFLD domain (Figure 5). Therefore the role of the NFLD domain may not be specific to ThiI, as previously suggested (28). Our model shows that THUMP
by itself does not present any particular concentration of positively charged residues, although its conserved residues map on the surface corresponding to the ThiI homolog (28). These results suggest that the THUMP domain is not necessarily responsible per se for the affinity of TrMet(m2,2G10) for tRNA but rather may be used to target the catalytic domain to a particular region of the tRNA structure. The results of our experiments show that the linker between THUMP
and the catalytic domain of PAB1283 is flexible. As it is highly basic, it may participate in nucleic acid binding.
Finally, we constructed a docking model of the two domains of PAB1283 onto the tRNA substrate (Figure 6 and Supplementary Data), based on experimental restraints from interactions between different elements of both molecules. This docking model confidently places the catalytic MTase domain of PAB1283 near the G10 nucleoside, at the junction between the anticodon stem and the D-stem, and the THUMP
domain at the co-axially stacked helices of the T-arm and the acceptor stem. Most of the interactions between the THUMP
domain and the tRNA occur through the phosphate backbone, suggesting that it is the RNA structure rather than the sequence that is recognized by THUMP
. Recently, it was found that the T-arm is an essential specificity determinant for PAB1283 (21). Likewise, the minimal substrate for the tRNA:s4U8 synthase ThiI from E.coli is an RNA mini-helix comprising the acceptor and T-stems (26). Thus, the specificity determinants of E.coli ThiI and TrMet(m2,2G10) appear to be strikingly similar, despite the fact that these enzymes use unrelated catalytic domains to carry out completely different reactions. If the C-terminal domain is removed from our docking model of PAB1283, the site of U8 is relatively exposed, so that the catalytic domain of the thiouridine synthase could be modeled to bind tRNA in a similar manner to that predicted for the MTase domain of PAB1283. In order that both enzymes carry out their respective reactions, some conformational rearrangement, such as base flipping (52) in the substrate tRNA must occur, to expose the target nucleoside and place it in the active site. Likewise, the Tan1 protein required for N4-acetylcytidine formation at position 12 appears to contain not only the THUMP domain, but also the N-terminal extension that exhibits a similar structure to the NFLD domain (J. M. Bujnicki, unpublished data). Thus, we postulate that ThiI thiolase, TrMet(m2,2G10) and the enzymes responsible for N4-acetylcytidine formation at position 12 possess a common THUMP
module [comprising the NFLD and THUMP (sub)domains] that should bind tRNA in a very similar manner.
In conclusion, our docking model provides a useful platform for future studies and can be tested experimentally. In particular, footprinting and cross-linking analyses could provide specific restraints for inter-residue distances that could be used to refine the current model. THUMP-domain containing protein Tan1 from S.cerevisiae is required for the formation of N4-acetylcytidine at position 12 (27), a nucleoside, which is located just between G10 and U8. It is of interest to determine what could be the minimal substrate for this enzyme. Interestingly, it remains to be determined if other tRNA-modifying enzymes that contain the THUMP domain interact with the substrate in a similar way as TrMet(m2,2G10), i.e. structured tRNA as target and the co-axially stacked helices of the T-arm and the acceptor stem as unmodified support. Such hypothesis may be the basis of original strategies to search for the function of these still uncharacterized THUMP-containing proteins.
| SUPPLEMENTARY DATA |
|---|
|
|
|---|
Supplementary Data are available at NAR Online.
| ACKNOWLEDGEMENTS |
|---|
The authors gratefully acknowledge Jaunius Urbonavicius (CNRS-LEBS, Gif-sur-Yvette, France) for stimulating discussions on THUMP-containing proteins and sharing information on TrMet(m2,2G10) minimal substrate prior to publication. We are indebted to Martine Roovers and Louis Droogmans (both from Université Libre de Bruxelles, Belgium) for sharing information on PsuX prior to publication. The authors thank the following colleagues (both from CEA VALRHO, DSV-DIEP-SBTN): Charles Marchetti for operating fermentor facilities and Jean-Charles Gaillard for assistance with Edman sequencing. J.M.B., M.J.G. and I.T. were supported by the Polish Ministry of Science (grant PBZ-KBN-088/P04/2003). J.M.B. is an EMBO/HHMI Young Investigator. H.G. was supported by a research grant from the CNRS (Programme Interdépartemental de Géomicrobiologie des Environnements Extrêmes GEOMEX 20022004). Funding to pay the Open Access publication charges for this article was provided by Commissariat à l'Energie Atomique, DSV-DIEP-SBTN.
Conflict of interest statement. None declared.
| REFERENCES |
|---|
|
|
|---|
- Rozenski, J., Crain, P.F., McCloskey, J.A. (1999) The RNA Modification Database: 1999 update Nucleic Acids Res, . 27, 196197
[Abstract/Free Full Text] . - Agris, P.F. (2004) Decoding the genome: a modified view Nucleic Acids Res, . 32, 223238
[Abstract/Free Full Text] . - Grosjean, H. and Benne, R. Modification and editing of RNA, (1998) Washington, DC ASM Press .
- Grosjean, H. Fine-Tuning of RNA Functions by Modification and Editing, (2005) Berlin-Heidelberg, NY Springer Verlag .
- Hopper, A.K. and Phizicky, E.M. (2003) tRNA transfers to the limelight Genes Dev, . 17, 162180
[Free Full Text] . - Björk, G.R. and Hagervall, T.G. (2005) Transfer RNA modification In Curtiss, R., IIIrd, Böck, A., Ingrahan, J.L., Kaper, J.B., Maloy, S., Neidhardt, F.C., Riley, M.M., Squires, C.L., Wanner, B.L. (Eds.). Escherichia coli and Salmonella. Cellular and Molecular Biology, Washington DC ASM Press pp. 4.6.2 .
- Dunin-Horkawicz, S., Czerwoniec, A., Gajda, M.J., Feder, M., Grosjean, H., Bujnicki, J.M. (2006) MODOMICS: a database of RNA modification pathways Nucleic Acids Res, . 34, D145D149
[Abstract/Free Full Text] . - Reader, J.S., Metzgar, D., Schimmel, P., de Crecy-Lagard, V. (2004) Identification of four genes necessary for biosynthesis of the modified nucleoside queuosine J. Biol. Chem, . 279, 62806285
[Abstract/Free Full Text] . - Armengaud, J., Urbonavicius, J., Fernandez, B., Chaussinand, G., Bujnicki, J.M., Grosjean, H. (2004) N2-methylation of guanosine at position 10 in tRNA is catalyzed by a THUMP domain-containing, S-adenosylmethionine-dependent methyltransferase, conserved in Archaea and Eukaryota J. Biol. Chem, . 279, 3714237152
[Abstract/Free Full Text] . - Bujnicki, J.M., Droogmans, L., Grosjean, H., Purushothaman, S.K., Lapeyre, B. (2004) Bioinformatics-guided identification and experimental characterization of novel RNA Methyltransferases In Bujnicki, J.M. (Ed.). Practical Bioinformatics, Berlin Heidelberg Springer-Verlag Vol. 15, pp. 139168 .
- Urbonavicius, J., Skouloubris, S., Myllykallio, H., Grosjean, H. (2005) Identification of a novel gene encoding a flavin-dependent tRNA:m5U methyltransferase in bacteriaevolutionary implications Nucleic Acids Res, . 33, 39553964
[Abstract/Free Full Text] . - Crecy-Lagard, V. (2004) Finding missing tRNA modification genes: a comparative genomics goldmine In Bujnicki, J.M. (Ed.). Nucleic Acids and Molecular Biology Series, Berlin Heidelberg Springer-Verlag pp. 169190 .
- Aravind, L. and Koonin, E.V. (1999) Novel predicted RNA-binding domains associated with the translation machinery J. Mol. Evol, . 48, 291302[CrossRef][Web of Science][Medline] .
- Anantharaman, V., Koonin, E.V., Aravind, L. (2002) Comparative genomics and evolution of proteins involved in RNA metabolism Nucleic Acids Res, . 30, 14271464
[Abstract/Free Full Text] . - Liu, Y. and Santi, D.V. (2000) m5C RNA and m5C DNA methyl transferases use different cysteine residues as catalysts Proc. Natl Acad. Sci. USA, 97, 82638265
[Abstract/Free Full Text] . - Watanabe, K., Hori, H., Endo, Y. (2001) Identification of essential amino acid residues of tRNA (Gm18)methyltransferase for methyl-transfer activity Nucleic Acids Res, . 3334 .
- Watanabe, K., Nureki, O., Fukai, S., Ishii, R., Okamoto, H., Yokoyama, S., Endo, Y., Hori, H. (2005) Roles of conserved amino acid sequence motifs in the SpoU (TrmH) RNA methyltransferase family J. Biol. Chem, . 280, 1036810377
[Abstract/Free Full Text] . - Purta, E., van Vliet, F., Tricot, C., De Bie, L.G., Feder, M., Skowronek, K., Droogmans, L., Bujnicki, J.M. (2005) Sequence-structure-function relationships of a tRNA (m7G46) methyltransferase studied by homology modeling and site-directed mutagenesis Proteins, 59, 482488[CrossRef][Web of Science][Medline] .
- Hoang, C., Hamilton, C.S., Mueller, E.G., Ferre-D'Amare, A.R. (2005) Precursor complex structure of pseudouridine synthase TruB suggests coupling of active site perturbations to an RNA-sequestering peripheral protein domain Protein Sci, . 14, 22012206[CrossRef][Web of Science][Medline] .
- Sabina, J. and Soll, D. (2006) The RNA-binding PUA domain of archaeal tRNA-guanine transglycosylase is not required for archaeosine formation J. Biol. Chem, . 281, 69337001 .
- Urbonavicius, J., Armengaud, J., Grosjean, H. (2006) Identity elements required for enzymatic formation of N2, N2-dimethylguanosine and its role in avoiding alternative conformations in archaeal tRNAs J. Mol. Biol, . 357, 387399[CrossRef][Web of Science][Medline] .
- Purushothaman, S.K., Bujnicki, J.M., Grosjean, H., Lapeyre, B. (2005) Trm11p and Trm112p are both required for the formation of 2-methylguanosine at position 10 in yeast tRNA Mol. Cell. Biol, . 25, 43594370
[Abstract/Free Full Text] . - Aravind, L. and Koonin, E.V. (2001) THUMP-a predicted RNA-binding domain shared by 4-thiouridine, pseudouridine synthases and RNA methylases Trends Biochem. Sci, . 26, 215217[CrossRef][Web of Science][Medline] .
- Palenchar, P.M., Buck, C.J., Cheng, H., Larson, T.J., Mueller, E.G. (2000) Evidence that ThiI, an enzyme shared between thiamin and 4-thiouridine biosynthesis, may be a sulfurtransferase that proceeds through a persulfide intermediate J. Biol. Chem, . 275, 82838286
[Abstract/Free Full Text] . - Mueller, E.G., Palenchar, P.M., Buck, C.J. (2001) The role of the cysteine residues of ThiI in the generation of 4-thiouridine in tRNA J. Biol. Chem, . 276, 3358833595
[Abstract/Free Full Text] . - Lauhon, C.T., Erwin, W.M., Ton, G.N. (2004) Substrate specificity for 4-thiouridine modification in Escherichia coli J. Biol. Chem, . 279, 2302223029
[Abstract/Free Full Text] . - Johansson, M.J. and Byström, A.S. (2004) The Saccharomyces cerevisiae TAN1 gene is required for N(4)-acetylcytidine formation in tRNA RNA, 10, 712719
[Abstract/Free Full Text] . - Waterman, D.G., Ortiz-Lombardia, M., Fogg, M.J., Koonin, E.V., Antson, A.A. (2006) Crystal structure of Bacillus anthracis ThiI, a tRNA-modifying enzyme containing the predicted RNA-binding THUMP domain J. Mol. Biol, . 356, 97110[CrossRef][Web of Science][Medline] .
- Armengaud, J., Fernandez, B., Chaumont, V., Rollin-Genetet, F., Finet, S., Marchetti, C., Myllykallio, H., Vidaud, C., Pellequer, J.L., Gribaldo, S., et al. (2003) Identification, purification, and characterization of an eukaryotic-like phosphopantetheine adenylyltransferase (coenzyme A biosynthetic pathway) in the hyperthermophilic archaeon Pyrococcus abyssi J. Biol. Chem, . 278, 3107831087
[Abstract/Free Full Text] . - Auxilien, S., Crain, P.F., Trewyn, R.W., Grosjean, H. (1996) Mechanism, specificity and general properties of the yeast enzyme catalysing the formation of inosine 34 in the anticodon of transfer RNA J. Mol. Biol, . 262, 437458[CrossRef][Web of Science][Medline] .
- Edgar, R.C. (2004) MUSCLE: multiple sequence alignment with high accuracy and high throughput Nucleic Acids Res, . 32, 17921797
[Abstract/Free Full Text] . - Kurowski, M.A. and Bujnicki, J.M. (2003) GeneSilico protein structure prediction meta-server Nucleic Acids Res, . 31, 33053307
[Abstract/Free Full Text] . - Kosinski, J., Cymerman, I.A., Feder, M., Kurowski, M.A., Sasin, J.M., Bujnicki, J.M. (2003) A FRankenstein's monster approach to comparative modeling: merging the finest fragments of Fold-Recognition models and iterative model refinement aided by 3D structure evaluation Proteins, 53, 369379 .
- Kosinski, J., Gajda, M.J., Cymerman, I.A., Kurowski, M.A., Pawlowski, M., Boniecki, M., Obarska, A., Papaj, G., Sroczynska-Obuchowicz, P., Tkaczuk, K.L., et al. (2005) FRankenstein becomes a cyborg: the automatic recombination and realignment of Fold-Recognition models in CASP6 Proteins, 61, 106113 .
- Fiser, A. and Sali, A. (2003) Modeller: generation and refinement of homology-based protein structure models Meth. Enzymol, . 374, 461491[Web of Science][Medline] .
- Luthy, R., Bowie, J.U., Eisenberg, D. (1992) Assessment of protein models with three-dimensional profiles Nature, 356, 8385[CrossRef][Medline] .
- Sasin, J.M. and Bujnicki, J.M. (2004) COLORADO3D, a web server for the visual analysis of protein structures Nucleic Acids Res, . 32, W586W589
[Abstract/Free Full Text] . - Pupko, T., Bell, R.E., Mayrose, I., Glaser, F., Ben-Tal, N. (2002) Rate4Site: an algorithmic tool for the identification of functional regions in proteins by surface mapping of evolutionary determinants within their homologues Bioinformatics, 18, S71S77[Abstract] .
- Katchalski-Katzir, E., Shariv, I., Eisenstein, M., Friesem, A.A., Aflalo, C., Vakser, I.A. (1992) Molecular surface recognition: determination of geometric fit between proteins and their ligands by correlation techniques Proc. Natl Acad. Sci. USA, 89, 21952199
[Abstract/Free Full Text] . - Romero, P., Obradovic, Z., Li, X., Garner, E.C., Brown, C.J., Dunker, A.K. (2001) Sequence complexity of disordered protein Proteins, 42, 3848[CrossRef][Web of Science][Medline] .
- Bowie, J.U., Luthy, R., Eisenberg, D. (1991) A method to identify protein sequences that fold into a known three-dimensional structure Science, 253, 164170
[Abstract/Free Full Text] . - Mallick, P., Boutz, D.R., Eisenberg, D., Yeates, T.O. (2002) Genomic evidence that the intracellular proteins of archaeal microbes contain disulfide bonds Proc. Natl Acad. Sci. USA, 99, 96799684
[Abstract/Free Full Text] . - Roovers, M., Wouters, J., Bujnicki, J.M., Tricot, C., Stalon, V., Grosjean, H., Droogmans, L. (2004) A primordial RNA modification enzyme: the case of tRNA (m1A) methyltransferase Nucleic Acids Res, . 32, 465476
[Abstract/Free Full Text] . - Kaplan, H., Stevenson, K.J., Hartley, B.S. (1971) Competitive labelling, a method for determining the reactivity of individual groups in proteins Biochem. J, . 124, 289299[Web of Science][Medline] .
- Bresciani, D. (1977) Different reactivities of free and bound amino groups in deoxy-and liganded haemoglobin Biochem. J, . 163, 393395[Web of Science][Medline] .
- Westhof, E., Dumas, P., Moras, D. (1988) Restrained refinement of two crystalline forms of yeast aspartic acid and phenylalanine transfer RNA crystals Acta Crystallogr. A, . 44, 112123 .
- Westhof, E., Dumas, P., Moras, D. (1983) Loop stereochemistry and dynamics in transfer RNA J. Biomol. Struct. Dyn, . 1, 337355[Web of Science][Medline] .
- Romby, P., Carbon, P., Westhof, E., Ehresmann, C., Ebel, J.P., Ehresmann, B., Giege, R. (1987) Importance of conserved residues for the conformation of the T-loop in tRNAs J. Biomol. Struct. Dyn, . 5, 669687[Web of Science][Medline] .
- Becker, H.F., Motorin, Y., Sissler, M., Florentz, C., Grosjean, H. (1997) Major identity determinants for enzymatic formation of ribothymidine and pseudouridine in the T psi-loop of yeast tRNAs J. Mol. Biol, . 274, 505518[CrossRef][Web of Science][Medline] .
- Ye, X., O'Neil, P.K., Foster, A.N., Gajda, M.J., Kosinski, J., Kurowski, M.A., Bujnicki, J.M., Friedman, A.M., Bailey-Kellogg, C. (2004) Probabilistic cross-link analysis and experiment planning for high-throughput elucidation of protein structure Protein Sci, . 13, 32983313[CrossRef][Web of Science][Medline] .
- Armengaud, J., Dedieu, A., Solques, O., Pellequer, J.L., Quemeneur, E. (2005) Deciphering structure and topology of conserved COG2042 orphan proteins BMC Struct. Biol, . 5, 3[CrossRef][Medline] .
- Roberts, R.J. and Cheng, X. (1998) Base flipping Annu. Rev. Biochem, . 67, 181198[CrossRef][Web of Science][Medline]
.
This article has been cited by other articles:
![]() |
Y. Tanaka, S. Yamagata, Y. Kitago, Y. Yamada, S. Chimnaronk, M. Yao, and I. Tanaka Deduced RNA binding mechanism of ThiI based on structural and binding analyses of a minimal RNA ligand RNA, August 1, 2009; 15(8): 1498 - 1506. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Awai, S. Kimura, C. Tomikawa, A. Ochi, Ihsanawati, Y. Bessho, S. Yokoyama, S. Ohno, K. Nishikawa, T. Yokogawa, et al. Aquifex aeolicus tRNA (N2,N2-Guanine)-dimethyltransferase (Trm1) Catalyzes Transfer of Methyl Groups Not Only to Guanine 26 but Also to Guanine 27 in tRNA J. Biol. Chem., July 31, 2009; 284(31): 20467 - 20478. [Abstract] [Full Text] [PDF] |
||||
![]() |
H. Walbott, S. Auxilien, H. Grosjean, and B. Golinelli-Pimpaneau The Carboxyl-terminal Extension of Yeast tRNA m5C Methyltransferase Enhances the Catalytic Efficiency of the Amino-terminal Domain J. Biol. Chem., August 10, 2007; 282(32): 23663 - 23671. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Roovers, C. Hale, C. Tricot, M. P. Terns, R. M. Terns, H. Grosjean, and L. Droogmans Formation of the conserved pseudouridine at position 55 in archaeal tRNA Nucleic Acids Res., September 10, 2006; 34(15): 4293 - 4301. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||








