Nucleic Acids Research Advance Access published online on August 2, 2008
Nucleic Acids Research, doi:10.1093/nar/gkn497
Nucleic Acid Enzymes |
The solution structure of the amino-terminal domain of human DNA polymerase
subunit B is homologous to C-domains of AAA+ proteins
1Faculty of Biosciences, University of Joensuu, PO Box 111, FI-80101 Joensuu, 2NMR Laboratory, Program in Structural Biology and Biophysics, Institute of Biotechnology, University of Helsinki, PO Box 65, FI-00014 Helsinki, 3Department of Biochemistry, University of Oulu, PO Box 3000, FI-90014 Oulu, Finland and 4Leibniz Institute for Age Research - Fritz Lipmann Institute, Beutenbergstrasse 11, D-07745 Jena, Germany
*To whom correspondence should be addressed. Tel: +1 49 3641 656297; Fax: +1 49 3641 656288; Email: pospiech{at}fli-leibniz.de
Received April 4, 2008. Revised June 13, 2008. Accepted July 19, 2008.
| ABSTRACT |
|---|
|
|
|---|
DNA polymerases
,
and
are large multisubunit complexes that replicate the bulk of the DNA in the eukaryotic cell. In addition to the homologous catalytic subunits, these enzymes possess structurally related B subunits, characterized by a carboxyterminal calcineurin-like and an aminoproximal oligonucleotide/oligosaccharide binding-fold domain. The B subunits also share homology with the exonuclease subunit of archaeal DNA polymerases D. Here, we describe a novel domain specific to the N-terminus of the B subunit of eukaryotic DNA polymerases
. The N-terminal domain of human DNA polymerases
(Dpoe2NT) expressed in Escherichia coli was characterized. Circular dichroism studies demonstrated that Dpoe2NT forms a stable, predominantly
-helical structure. The solution structure of Dpoe2NT revealed a domain that consists of a left-handed superhelical bundle. Four helices are arranged in two hairpins and the connecting loops contain short β-strand segments that form a short parallel sheet. DALI searches demonstrated a striking structural similarity of the Dpoe2NT with the
-helical subdomains of ATPase associated with various cellular activity (AAA+) proteins (the C-domain). Like C-domains, Dpoe2NT is rich in charged amino acids. The biased distribution of the charged residues is reflected by a polarization and a considerable dipole moment across the Dpoe2NT. Dpoe2NT represents the first C-domain fold not associated with an AAA+ protein. | INTRODUCTION |
|---|
|
|
|---|
Early cellular evolution was accompanied by gross genetic rearrangements (1–3), which resulted in apparent modularity of proteins (4) and in unexpected structural similarities and dissimilarities among cellular forms of life (5,6). Modular proteins involved in DNA metabolism, including DNA polymerases (Pols), have been particularly focused upon in research (7). In the eukaryotic cell, it is the family B Pols
,
and
that replicate the bulk of the nuclear DNA. These enzymes are all large multisubunit and multidomain complexes. The largest catalytic subunit A contains the motifs for DNA polymerase and in the case of Pols
and
, proofreading 3'-exonuclease activities (8). Subunit B belongs to a superfamily of B subunits conserved among eukaryotic family B Pols
,
and
(9,10). Surprisingly, this family also contains subunits of archaeal family D Pols, whose large subunits do not show any homology to family B Pols, except for putative zinc fingers. In this B-subunit superfamily, a calcineurin-like phopshoesterase domain spanning the C-terminal half of the B subunit is separated from an amino-proximal OB (oligonucleotide/oligosaccharide binding)-fold domain (11) by a short proline-rich region (9). The seven residues involved in metal coordination and catalysis in the calcineurin-like phosphoesterase domain are conserved in archaeal B-subunits but disrupted in their eukaryotic counterparts (10). Consistent with the conservation of the phosphoesterase domain, the B-subunit of Methanococcus jannaschii has been subsequently found to display 3'-exonuclease activity (12).
Pol
is needed for the chromosomal DNA replication in eukaryotic cells, probably as the enzyme that synthesises the leading strand (13–16). Pol
has also been implicated in many functions independent of DNA replication (13). Human Pol
is composed of four subunits, A–D, with molecular weights of 262, 60, 12 and 17 kDa, respectively. Subunits A and B are essential for the viability of yeast cells, while the histone-fold subunits C and D are not. Low-resolution structures of yeast Pol
, determined by cryo-electron microscopy, indicate that the three small subunits form an extended structure that is flexibly connected to a larger globular domain formed by the catalytic subunit A (17).
We report here the identification of a novel conserved domain in the very N-terminal end of human Pol
subunit B (Dpoe2). Structural characterization by means of solution state NMR indicates a close structural relationship of this domain with the carboxyproximal
-helical domain of AAA+ proteins (ATPases associated with various cellular activities).
| MATERIALS AND METHODS |
|---|
|
|
|---|
DNA constructs and preparation of protein samples
Cloning
DNA insert corresponding to amino acids 1–75 of human Pol
subunit B was amplified by conventional PCR with primers 5'-CGTGGATCCGTCGACATGGCGCCGGAGCGGCTGCGGAG-3' and 5'-TTGAATTCTCGAGATTAACTGGATTCCTGGACTGCTGC-3', and plasmid harboring human POLE2 cDNA as the template. SalI and XhoI digested insert was ligated to SalI, XhoI and CIP-treated pRSFDuet-1 vector (Novagen, Gibbstown, New Jersey, USA). The resulting construct encodes the peptide sequence: MGSSHHHHHHSQDPNSSSARLQVDMAPERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQESS. The peptide contains a histidine affinity purification tag (aa 1–24, italics) followed by the sequence representing the amino-terminus of Dpoe2 (aa 25–99). The amino acid substitution C98S is underlined.
Production of labeled samples for NMR
Escherichia coli (BL21[DE3]) cells carrying the plasmid described above were grown to saturation at +37°C in 5.5 ml of LB medium supplemented with 35 µg/ml of kanamycin. The culture was diluted in a stepwise manner to M9 labeling medium with 2.0 g/l of 13C D-glucose and 1.0 g/l of 15N–NH4Cl as the only source of carbon and nitrogen, respectively, and supplemented with MEM-vitamins (Sigma, St. Louis, Missouri, USA) and antibiotics to a final volume of 300 ml. Isotope labels were all purchased from Spectra, Andover, MD, USA, at >99% grade. Temperature was gradually decreased during the dilution. When temperature was stabilized to +25°C and cell density reached OD600 0.4, the protein expression was induced by adding IPTG to a final concentration of 0.65 mM. Cells were harvested by centrifugation when the culture had reached OD600 1.8.
Protein purification
Cells were suspended and incubated in lysis buffer (0.5 M NaCl, 50 mM MgCl2, 0.3% Triton-X-100 and lysozyme in 100 mM Tris–HCl, pH 6.8). Lysis was completed by brief pulses of ultrasonication. The solution was clarified by centrifugation and Ni-chelating sepharose particles were added to the supernatant. Particles were collected, washed once with 10 vol. of lysis buffer and twice with washing buffer (0.5 M NaCl in 100 mM Tris–HCl, pH 6.8). Proteins were eluted with an elution buffer (0.5 M NaCl, 0.5 M imidazole, pH 6.5). The eluted fraction was microfiltered and dialyzed against the NMR buffer (155 mM NaCl, 25 mM Tris–HCl, 25 mM imidazole, 1.25 mM EDTA, pH 6.62). As estimated by SDS–PAGE the purity of the protein was 80–90% with no prominent contaminant. D2O was added to protein solution prior to structure determination to a final concentration of 7% (v/v). The concentration of the protein was 0.6–0.8 mM. Unlabeled protein samples for circular dichroism (CD) spectroscopy were prepared as mentioned earlier, with the exception that M9-medium was substituted with standard LB medium supplemented with kanamycin. Due to the high expression levels in LB medium, a purity of >95% was reached. Samples were microfiltered and dialyzed against a 10 mM potassium phosphate buffer, pH 8.2.
CD spectroscopy
The Bradford method with BSA as a standard was used for adjustment of the protein concentrations for CD spectroscopy, which was carried out at 20°C using a Jasco, Easton, MD, USA, J-715 spectropolarimeter with a Jasco PFD-3505 temperature controller. The far-UV spectra of the proteins (0.125 mg/ml) were measured from 190 nm to 250 nm in 5 mM potassium phosphate, pH 8.2, with the following settings: response, 1 s; speed, 50 nm/min; path length, 1 mm; band width 1 nm; average of eight scans. The mean molar ellipticities were calculated with Jasco software. Quantitative estimations of the secondary structure content were made with the aid of the programs CDSSTR, CONTIN and SELCON3 included in the CDPro software package (http://lamar.colostate.edu/~sreeram/CDPro) (18). The melting curve was generated by monitoring the protein solution at 222 nm over a temperature gradient of 20–98°C in a CD spectrometer with the following instrument settings: temperature increase, 30°C/h; response, 16 s; and path length, 1 mm. The temperature titration was followed by an immediate reverse scan over the same temperature range to study the reversibility of the unfolding.
NMR spectroscopy and structure determination
NMR spectra for the structure determination were acquired at 25°C on Varian Unity Inova spectrometers operating at 600 and 800 MHz 1H frequencies, equipped with 5 mm triple resonance probeheads and actively shielded z- and xyz-axis gradient systems. Spectra were processed with Vnmr 6.1 revision C (Varian Inc., Palo Alto, CA, USA), and analyzed with Sparky 3.106 (19). A set of 3D experiments, i.e. HNCA, HN(CO)CA, iHNCA, HNCACB, HN(CO)CACB and HNCO were utilized in backbone assignment (20,21). Aliphatic side-chain assignment was accomplished using 3D H(CCO)NH, CC(CO)NH and HCCH-COSY experiments. A combination of (Hβ)Cβ(C
C
)H
, (Hβ)Cβ(C
C
C
)H
(22), and NOE experiments were employed for the assignment of aromatic side-chains. NOE peaks were picked from a 3D 15N-edited NOESY-HSQC (23), and a 13C-edited NOESY-HSQC (24) spectrum, modified to simultaneously excite aliphatic and aromatic carbon resonances. The NOE signal assignment and structure calculations, based on NOE-peak intensities, were made automatically by the program CYANA (25). Three hundred conformers were generated, and the 30 conformers with the lowest target function values were subjected to restrained energy minimization with AMBER 8 (26). AMBER refinement consisted of a cycle of simulated annealing using the generalized Born implicit solvent model. Structures were analyzed with PROCHECK-NMR (27). A final family of 20 structures with the lowest NOE restraint violation energies was selected to represent the Dpoe2NT structure in solution.
Bioinformatics
Multiple sequence alignment was generated by ClustalW (28), using the Gonnet matrix. Sequence alignments were revised with secondary structure prediction data retrieved from the PredictProtein Server (29). Multiple sequence alignments were managed with a genedoc sequence editor (30).
When searching for structural homologs, superimposition of molecular structures, structural comparison and alignments following www servers and programs were utilized: DALI (31), DaliLite (32), CATHedral (33), MOLMOL (34) and Swiss-PdbViewer (35). Structure searches and comparisons were performed by using structural model no. 1 (residues 25–99) as a representative structure for Dpoe2NT. Dipole moments for all isolated domain structures were calculated at http://bip.weizmann.ac.il/dipol (36). HMM–HMM homology searches were performed at the HHPred server (37).
Database deposition
The atomic coordinates, NMR restraint data and chemical shifts for the 6His-tagged amino-terminal domain of Pol
subunit B have been deposited at the EBI Macromolecular Structure Database (EBI-MSD), with the use of the PDB AutoDep database deposition tool, and in the RCSD Protein Data Bank (PDB) under the PDB code 2v6z.
| RESULTS AND DISCUSSION |
|---|
|
|
|---|
A novel domain in the aminoterminus of Pol
subunit BPrevious studies have identified a C-terminal calcineurin-like phosphoesterase domain (10) and an OB-fold domain (11) within the B subunits of eukaryotic Pols
,
and
, as well as archaeal Pol D, whereas the N-terminal part of the B subunits shows very poor conservation. We re-analyzed the sequence aminoproximal to the OB-fold domain of Dpoe2, the human Pol
B subunit. Sequence comparison revealed a previously unidentified region of conservation corresponding to the first 75 amino acids of human Dpoe2 (Figure 1). A regular pattern of charged and hydrophobic residues suggests a conserved fold. Independent secondary structure predictions of sequences from representative species indicate that the amino terminus of eukaryotic Pol
B subunits may form a bundle of four helices. In contrast, the neighboring region, corresponding to amino acids 76–180 of Dpoe2, shows no apparent sequence conservation, suggesting that it is largely disordered.
|
As sequence alignments and secondary structure predictions suggested that the N-terminus of human Dpoe2 forms an independent domain, we expressed this region (aa 1–75) with an aminoterminal 6xHis-tag separated by a flexible linker as a recombinant protein (His-Dpoe2NT) in E. coli. The fragment was well expressed and soluble, and could be purified to near homogeneity by utilizing a chelating column (Supplementary Figure 1A). The purified protein was subjected to CD studies. The far-UV CD spectrum exhibited double minima at 208 and 222 nm, characteristic for
-helical structures (Supplementary Figure 1B). The CD spectrum of the native protein was analyzed by the CDPro package (18). The CDSSTR, CONTIN and SELCON3 algorithms predicted similar secondary structure compositions of 58%
-helix, 7% β-strand, 14% β-turns and 20% random coil. The predicted random fold content could be derived from the purification tag that comprises 24% of the total protein.
Temperature titration revealed considerable thermal stability of recombinant His-Dpoe2NT (Supplementary Figure 1C). The melting point Tm was estimated to be 71.4°C from the first and second derivative of the temperature titration and 70.3°C from the van't Hoff plot. We found that the temperature-dependent change in ellipticity at 222 nm was
80% reversible. The high Tm, together with the considerable degree of reversibility of thermal unfolding, supports the view that the N-terminus of Dpoe2 is folded as an independent, compact domain.
The NMR structure of the Dpoe2NT
Based on observations on protein stability and conservation, we expressed and purified the fully 13C-/15N-labeled His-Dpoe2NT protein for structure determination by NMR.
The 15N-HSQC spectrum of Dpoe2NT showed moderately dispersed resonances typical for a highly
-helical protein. In total, 91.3% of all 1H resonances were assigned (Figure 2). The missing assignments belong to the very first 11 residues belonging to the N-terminal His-tag. Assignment of the 13 leucine residues was particularly challenging due to heavily overlapping chemical shifts, especially in methyl groups. Structure calculation was carried out automatically using the program CYANA. A total of 1488 nonredundant NOE distance restraints, obtained from 3D 15N- and 13C-edited NOESY spectra, were assigned by the NOEASSIGN algorithm in CYANA. The automatic method was employed to calculate 300 initial structures. Of these, 30 structures with the lowest target functions were selected and subsequently energy-minimized with AMBER to obtain the final ensemble of 20 structures, representing Dpoe2NT in solution. The 1439 NOE restraints were evenly distributed through residues 25–99 of the construct that constituted the Dpoe2NT. The additional 49 restraints occupied the amino-terminal His-tag (residues 1–24 of the construct) and included no long-range NOEs and only two medium range NOEs. Special care was taken to verify that the first 25 residues not belonging to the native sequence of Dpoe2NT would not contribute to the automatic NOE assignment and structure calculation procedure in CYANA. We also analyzed our structure by verifying its NOE completeness as described by Doreleijers et al. (38). The results indicate, by neglecting intraresidual restraints, a NOE completeness of 71, 54 and 22% for 3, 4 and 5 Å cut-offs, respectively. This fits well with the average values found for 97 proteins, i.e. 68 ± 14%, 48 ± 13% and 26 ± 9% (38). A summary of the structural statistics is provided in Table 1, and an ensemble of the 20 final structures with the lowest NOE restraint violation energies for the human Dpoe2NT is displayed in Figure 3A. The 20 best conformers had very good covalent geometry and small energy terms (Table 1). A structure quality analysis by PROCHECK-NMR (27) revealed 92.5, 7.1 and 0.4% of the protein residues in the most favored, additionally allowed and generously allowed regions of the Ramachandran plot, respectively. Overall, the structure ensemble is well defined, except for the less well-ordered N-terminal residues 25–31 of Dpoe2NT (Figure 3A–C). Even for this part, the majority of the structures exhibit at least moderate helicity. For the well-ordered residues 32–99, backbone and heavy atoms show a RMSD of 0.37 ± 0.07 and 0.80 ± 0.06 Å, respectively.
|
|
|
The human Dpoe2NT consists of a left-handed superhelix bundle that is formed by four
-helices. The helices are arranged in two hairpins, and the two helices of each of the hairpins are connected by a loop that contains a short β-strand each. These two strands, composed of residues 44–46 and 84–86, are arranged into a parallel sheet (Figure 3B). Notably, the loops that connect the
-helices in the bundle superimpose tightly in the structure ensemble, suggesting that they are well ordered in solution (Figure 3A and C). The less ordered amino acid residues 25–31 in the N-terminal part are constructed based on only a few long-range NOEs, but with an average number of sequential and medium range NOEs. Consequently, the structure of Dpoe2NT is more loosely defined for residues 25–31. Nevertheless, all of the structures in the ensemble show an apparent helical nature down to the very near amino terminal end of the Dpoe2- sequence of the construct, based on sequential and short-range NOEs. For further analysis of the structure, we selected model number one of the final ensemble with the lowest NOE restraint violation energy to represent the structure.
Structural similarity to AAA+ C-domains
A search at the DALI database (31) with the Dpoe2NT (residues 25–99) revealed the carboxyproximal,
-helical domains of AAA+ proteins (the C-domains) as the best structural homologs. The C-domain of the E. coli Pol III
clamp loader subunit (PDB code 1jqjC) aligned with the Dpoe2NT as the best DALI database hit, with a Z-score of 8.6, followed by C-domains of several other AAA+ family subgroups (Table 2). The AAA+ superfamily represents a large group of enzymes associated with the assembly, disassembly and operation of protein complexes (39,40). AAA+ proteins are characterized by an N-terminal Rossman-fold that contains the Walker-A and -B motifs that form the NTPase domain, fused to a small C-proximal
-helical bundle that forms the lid of the ATP-binding pocket (the C-domain) (Figure 4A). The C-domain is an important distinguishing feature of the AAA+ superfamily in comparison to other NTP-binding proteins (40). AAA+ proteins function by linking conformational changes inferred by nucleotide binding and hydrolysis within an oligomeric assembly (41). AAA+ proteins have been classified into different clades and clusters based on their amino acid sequence as well as structural features (42,43). Although AAA+ proteins are functionally remarkably diverse, several groups of this family are involved in DNA metabolism. These include clamp loaders, the Holliday junction migration motor protein RuvB and RuvB-like proteins, MCM-like helicases and the Orc/DnaA group of cellular DNA replication initiators (44,45). Among AAA+ proteins, clamp loaders and RuvB and RuvB-like proteins represented the best DALI hits when searching with the Dpoe2NT domain as bait, followed by archaeal and eukaryotic replication initiator proteins Cdc6 and ORC. The first hit that did not belong to the AAA+ family was the histone fold protein (1f1eA) from Methanopyrus kandleri at rank 13. Reciprocal searches with the C-domains identified in the initial search indicate that Dpoe2NT aligns with C-domains with Dali search Z-scores and RMSD values comparable to the alignment of C-domains with each other (Supplementary Table 1). Parallel searches with the CATHedral-server (33) gave similar results, the majority of the top-listed folds being C-domains and falling into topological class 1.10.8 and superfamily 1.10.8.6
[EC]
0 (data not shown). Superimposition of the Dpoe2NT with C-domains of AAA+ proteins confirms that the structures align well (Figure 4A and B). It also becomes apparent that these proteins share the same topology, composed of a four-helix bundle and a short parallel β-sheet (43). Most significantly, the structure of Dpoe2NT represents, to the best of our knowledge, the first report of a C-domain fold that is not in the context of the AAA+ protein superfamily.
|
|
The Dpoe2NT domain and the C-domains of AAA+ proteins are both rich in charged amino acids. The structures presented in Figure 4B contain 30.0% (±5.4%) of charged amino acids. In the Dpoe2NT and the majority of the C-domain structures, the parallel helices
1 and
3 are predominantly positively charged, while acidic side-chains are distributed in the structures, and mostly locate in the loops, the strands and in the less conserved
4 (Figures 1 and 4C
One of the conserved sequence motifs of AAA+ proteins is located in the loop between the second and third helix of the C-domain (46). This sensor-2 motif is characterized by a conserved arginine residue that is implicated in the sensing of ATP binding and hydrolysis. A motif that corresponds to the sensor-2 cannot be recognized in Dpoe2NT. The arginine site of the sensor-2 motif is occupied by a glutamate in the human Dpoe2NT and by an acidic residue in the majority of its eukaryotic orthologs (Figures 1 and 4C
). This is reminiscent of the classical AAA+ clade that has a conserved aspartate instead of arginine (41). In the Dpoe2NT domain, the stem of helix
3 is rich in acidic residues, and there are insertions in the loops preceding and following helix
3. These result in distortion, particularly in the stem of helix
3 (Figure 4A and B). When superimposed onto C-domains in the contexts of functional AAA+ proteins, one can see that the acidic loop would extend towards the position occupied by the phosphoric acid residues of the ATP/ADP molecule. Taken together, it is therefore highly unlikely that Dpoe2NT could sense ATP/ADP in the context of AAA+ protein complexes, albeit mimic or compensation of the acid moiety of nucleotides cannot be excluded.
Evolutionary implications
The structural similarities with a variety of C-domains of AAA+ proteins involved in DNA metabolism, in particular with bacterial RuvB and clamp loader subunits, raise the question whether Dpoe2NT was acquired by partial gene transfer or genetic rearrangement, or if Dpoe2NT represents merely an analogous structure that has adapted the same fold without evolutionary relationship to the C-domains. Evolutionary relationship between structures has been implied by the presence of sequence homology or a similar function in addition to the related fold (47–49). Since normal and profile-based searches did not detect sequence homology between Dpoe2NT and AAA+, we utilized the highly sensitive HHPred server that uses HMM–HMM comparison (37). Searches with full-length Dpoe2 sequences from different species identified exclusively C-domains of AAA+ proteins as potential sequence homologs of Dpoe2NT, albeit with only moderate probability values (45–89%). Again, C-domains of AAA+ proteins involved in DNA metabolism, such as clamp loaders, RuvB Holliday junction resolvase or DnaA helicase, were detected (data not shown). Several searches with Dpoe2 identified also C-domains, when the secondary structure scoring was turned off, indicating that the hits were not only based on the similarity in secondary structure.
Taken together, Dpoe2NT shares (i) a common fold, (ii) common electrostatic characteristics (50) and (iii) remote sequence homology with C-domains of AAA+ proteins. Furthermore, Dpoe2NT is implicated in DNA metabolism, as are the most similar C-domains. Collectively, these properties strongly suggest a common evolutionary origin of Dpoe2NT with the C-domains. Recently, Alva and co-workers (51) have proposed a common origin for the N-terminal substrate recognition domain of Clp/Hsp100 proteins, the C-domains of AAA+ proteins, and for the histone fold. The authors suggest that these folds are all derived from an antecedent helix–strand–helix segment (51). This study extends the list to the N-terminal domain of Pol
B subunit.
| SUPPLEMENTARY DATA |
|---|
|
|
|---|
Supplementary Data are available at NAR Online.
| ACKNOWLEDGEMENTS |
|---|
The authors would like to thank Rikkert Wierenga for critical comments on the article. This work was funded by grants from the Academy of Finland that were awarded to J.E.S, H.P. and P.P. The work was also supported by the ISB (The National Graduate School in Informational and Structural Biology) and by a grant from the North Karelian Foundation of the Finnish Cultural Foundation awarded to T.N. Funding to pay the Open Access publication charges for this article was provided by the Leibniz Institute for Age Research - Fritz Lipmann Institute.
Conflict of interest statement. None declared.
| REFERENCES |
|---|
|
|
|---|
- Forterre P. The two ages of the RNA world, and the transition to the DNA world: a story of viruses and cells. Biochimie (2005) 87:793–803.[CrossRef][ISI][Medline]
- Yanai I, Wolf YI, Koonin EV. Evolution of gene fusions: horizontal transfer versus independent events. Genome Biol. (2002) 3. research0024.1–research0024.13.
- Makarova KS, Wolf YI, Mekhedov SL, Mirkin BG, Koonin EV. Ancestral paralogs and pseudoparalogs and their role in the emergence of the eukaryotic cell. Nucleic Acids Res. (2005) 33:4626–4638.
[Abstract/Free Full Text] - Leipe DD, Aravind L, Koonin EV. Did DNA replication evolve twice independently? Nucleic Acids Res. (1999) 27:3389–3401.
[Abstract/Free Full Text] - Robinson NP, Bell SD. Origins of DNA replication in the three domains of life. FEBS J. (2005) 272:3757–3766.[CrossRef][Medline]
- Kelman Z, ODonnell M. Structural and functional similarities of prokaryotic and eukaryotic DNA polymerase sliding clamps. Nucleic Acids Res. (1995) 23:3613–3620.
[Abstract/Free Full Text] - Koonin EV. Temporal order of evolution of DNA replication systems inferred by comparison of cellular and viral DNA polymerases. Biol. Direct. (2006) 1:39.[CrossRef][Medline]
- Braithwaite DK, Ito J. Compilation, alignment, and phylogenetic relationships of DNA polymerases. Nucleic Acids Res. (1993) 21:787–802.
[Free Full Text] - Mäkiniemi M, Pospiech H, Kilpeläinen S, Jokela M, Vihinen M, Syväoja JE. A novel family of DNA-polymerase-associated B subunits. Trends Biochem. Sci. (1999) 24:14–16.[CrossRef][ISI][Medline]
- Aravind L, Koonin EV. Phosphoesterase domains associated with DNA polymerases of diverse origins. Nucleic Acids Res. (1998) 26:3746–3752.
[Abstract/Free Full Text] - Koonin EV, Wolf YI, Aravind L. Protein fold recognition using sequence profiles and its application in structural genomics. Adv. Protein Chem. (2000) 54:245–275.[ISI][Medline]
- Jokela M, Eskelinen A, Pospiech H, Rouvinen J, Syväoja JE. Characterization of the 3' exonuclease subunit DP1 of Methanococcus jannaschii replicative DNA polymerase D. Nucleic Acids Res. (2004) 32:2430–2440.
[Abstract/Free Full Text] - Pospiech H, Syväoja JE. DNA polymerase epsilon - more than a polymerase. ScientificWorldJournal (2003) 3:87–104.[CrossRef][Medline]
- Fukui T, Yamauchi K, Muroya T, Akiyama M, Maki H, Sugino A, Waga S. Distinct roles of DNA polymerases delta and epsilon at the replication fork in Xenopus egg extracts. Genes Cells (2004) 9:179–191.
[Abstract/Free Full Text] - Rytkönen AK, Vaara M, Nethanel T, Kaufmann G, Sormunen R, Läärä E, Nasheuer HP, Rahmeh A, Lee MY, Syväoja JE, Pospiech H. Distinctive activities of DNA polymerases during human DNA replication. FEBS J. (2006) 273:2984–3001.[CrossRef][Medline]
- Pursell ZF, Isoz I, Lundström EB, Johansson E, Kunkel TA. Yeast DNA polymerase epsilon participates in leading-strand DNA replication. Science (2007) 317:127–130.
[Abstract/Free Full Text] - Asturias FJ, Cheung IK, Sabouri N, Chilkova O, Wepplo D, Johansson E. Structure of Saccharomyces cerevisiae DNA polymerase epsilon by cryo-electron microscopy. Nat. Struct. Mol. Biol. (2006) 13:35–43.[CrossRef][ISI][Medline]
- Sreerama N, Woody RW. Estimation of protein secondary structure from circular dichroism spectra: comparison of CONTIN, SELCON, and CDSSTR methods with an expanded reference set. Anal. Biochem. (2000) 287:252–260.[CrossRef][ISI][Medline]
- Goddard TD, Kneller DG. Sparky 3. (2004) San Francisco: University of California.
- Sattler M, Schleucher J, Griesinger C. Heteronuclear multidimensional NMR experiments for the structure determination of proteins in solution employing pulsed field gradients. Progr. NMR Spectr. (1999) 34:93–158.[CrossRef]
- Permi P. Intraresidual HNCA: an experiment for correlating only intraresidual backbone resonances. J. Biomol. NMR (2002) 23:201–209.[CrossRef][ISI][Medline]
- Yamazaki T, Forman-Kay JD, Kay LE. Two-dimensional NMR experiments for correlating 13Cβ and 1H
/
chemical shifts of aromatic residues in 13C-labeled proteins via scalar couplings. J. Am. Chem. Soc. (1993) 115:11054–11055.[CrossRef][ISI] - Zhang O, Kay LE, Olivier JP, Forman-Kay JD. Backbone 1H and 15N resonance assignments of the N-terminal SH3 domain of drk in folded and unfolded states using enhanced-sensitivity pulsed field gradient NMR techniques. J. Biomol. NMR (1994) 4:845–858.[CrossRef][ISI][Medline]
- Muhandiram DR, Farrow NA, Guang-yi X, Smallcombe SH, Kay LE. A gradient 13C NOESY-HSQC experiment for recording NOESY spectra of 13C-labeled proteins dissolved in H2O. J. Magn. Reson. (1993) B102:317–321.[CrossRef][ISI]
- Herrmann T, Guntert P, Wuthrich K. Protein NMR structure determination with automated NOE assignment using the new software CANDID and the torsion angle dynamics algorithm DYANA. J. Mol. Biol. (2002) 319:209–227.[CrossRef][ISI][Medline]
- Case DA, Cheatham T.E. III, Darden T, Gohlke H, Luo R, Merz K.M. Jr, Onufriev A, Simmerling C, Wang B, Woods RJ. The Amber biomolecular simulation programs. J. Comp. Chem. (2005) 26:1668–1688.[CrossRef]
- Laskowski RA, Rullmannn JA, MacArthur MW, Kaptein R, Thornton JM. AQUA and PROCHECK-NMR: programs for checking the quality of protein structures solved by NMR. J. Biomol. NMR (1996) 8:477–486.[ISI][Medline]
- Thompson JD, Higgins DG, Gibson TJ. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. (1994) 22:4673–4680.
[Abstract/Free Full Text] - Rost B, Yachdav G, Liu J. The PredictProtein server. Nucleic Acids Res. (2004) 32:W321–W326.
[Abstract/Free Full Text] - Nicholas KB, Nicholas H.B. Jr, Deerfield D.W. II. GeneDoc: Analysis and visualization of genetic variation. Embnew. News (1997) 4:14.[Medline]
- Holm L, Sander C. Protein structure comparison by alignment of distance matrices. J. Mol. Biol. (1993) 233:123–138.[CrossRef][ISI][Medline]
- Holm L, Park J. DaliLite workbench for protein structure comparison. Bioinformatics (2000) 16:566–567.
[Abstract/Free Full Text] - Pearl FM, Bennett CF, Bray JE, Harrison AP, Martin N, Shepherd A, Sillitoe I, Thornton J, Orengo CA. The CATH database: an extended protein family resource for structural and functional genomics. Nucleic Acids Res. (2003) 31:452–455.
[Abstract/Free Full Text] - Koradi R, Billeter M, Wuthrich K. MOLMOL: a program for display and analysis of macromolecular structures. J. Mol. Graph. (1996) 14:29–32.
- Schwede T, Kopp J, Guex N, Peitsch MC. SWISS-MODEL: An automated protein homology-modeling server. Nucleic Acids Res. (2003) 31:3381–3385.
[Abstract/Free Full Text] - Felder CE, Prilusky J, Silman I, Sussman JL. A server and database for dipole moments of proteins. Nucleic Acids Res. (2007) 35:W512–W521.
[Abstract/Free Full Text] - Söding J, Biegert A, Lupas AN. The HHpred interactive server for protein homology detection and structure prediction. Nucleic Acids Res. (2005) 33:W244–W248.
[Abstract/Free Full Text] - Doreleijers JF, Raves ML, Rullmann T, Kaptein R. Completeness of NOEs in protein structure: a statistical analysis of NMR. J. Biomol. NMR (1999) 14:123–132.[CrossRef][ISI][Medline]
- Neuwald AF, Aravind L, Spouge JL, Koonin EV. AAA+: A class of chaperone-like ATPases associated with the assembly, operation, and disassembly of protein complexes. Genome Res. (1999) 9:27–43.
[Abstract/Free Full Text] - Hanson PI, Whiteheart SW. AAA+ proteins: have engine, will work. Nat. Rev. Mol. Cell Biol. (2005) 6:519–529.[CrossRef][ISI][Medline]
- Erzberger JP, Berger JM. Evolutionary relationships and structural mechanisms of AAA+ proteins. Annu. Rev. Biophys. Biomol. Struct. (2006) 35:93–114.[CrossRef][ISI][Medline]
- Iyer LM, Leipe DD, Koonin EV, Aravind L. Evolutionary history and higher order classification of AAA+ ATPases. J. Struct. Biol. (2004) 146:11–31.[CrossRef][ISI][Medline]
- Ammelburg M, Frickey T, Lupas AN. Classification of AAA+ proteins. J. Struct. Biol. (2006) 156:2–11.[ISI][Medline]
- Giraldo R. Common domains in the initiators of DNA replication in Bacteria, Archaea and Eukarya: combined structural, functional and phylogenetic perspectives. FEMS Microbiol. Rev. (2003) 26:533–554.[CrossRef][ISI][Medline]
- Neuwald AF. Evolutionary clues to eukaryotic DNA clamp-loading mechanisms: analysis of the functional constraints imposed on replication factor C AAA+ ATPases. Nucleic Acids Res. (2005) 33:3614–3628.
[Abstract/Free Full Text] - Guenther B, Onrust R, Sali A, ODonnell M, Kuriyan J. Crystal structure of the delta subunit of the clamp-loader complex of E. coli DNA polymerase III. Cell (1997) 91:335–345.[CrossRef][ISI][Medline]
- Russell RB, Saqi MA, Sayle RA, Bates PA, Sternberg MJ. Recognition of analogous and homologous protein folds: analysis of sequence and structure conservation. J. Mol. Biol. (1997) 269:423–439.[CrossRef][ISI][Medline]
- Matsuo Y, Bryant SH. Identification of homologous core structures. Proteins (1999) 35:70–79.[CrossRef][ISI][Medline]
- Dietmann S, Holm L. Identification of homology in protein structure classification. Nat. Struct. Biol. (2001) 8:953–957.[CrossRef][ISI][Medline]
- Livesay DR, Jambeck P, Rojnuckarin A, Subramaniam S. Conservation of electrostatic properties within enzyme families and superfamilies. Biochemistry (2003) 42:3464–3473.[CrossRef][ISI][Medline]
- Alva V, Ammelburg M, Soding J, Lupas AN. On the origin of the histone fold. BMC Struct. Biol. (2007) 7:17.[CrossRef][Medline]
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||



5), in dark red, blue, light blue and yellow, respectively from bottom to top. The black curve indicates local backbone heavy atom RMSDs. The program MOLMOL (